Carboxylesterase 1C Protein, Mouse (P.pastoris, His)
Based on 1 Customer Validation
The carboxylesterase 1C protein is essential for xenobiotic detoxification and ester/amide prodrug activation, as well as participating in extracellular metabolism. Its multifunctional effects include processing of pulmonary surfactant. Carboxylesterase 1C Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Carboxylesterase 1C protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The carboxylesterase 1C protein is essential for xenobiotic detoxification and ester/amide prodrug activation, as well as participating in extracellular metabolism. Its multifunctional effects include processing of pulmonary surfactant. Carboxylesterase 1C Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Carboxylesterase 1C protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
The Carboxylesterase 1C Protein plays a crucial role in the detoxification of xenobiotics and the activation of ester and amide prodrugs. This versatile enzyme is actively engaged in extracellular metabolism, particularly contributing to the processing of lung surfactant. Its involvement in both xenobiotic metabolism and prodrug activation underscores its significance in cellular defense mechanisms and therapeutic interventions. The dual functions of Carboxylesterase 1C highlight its ability to modulate the bioavailability of drugs and facilitate the breakdown of foreign substances, illustrating its vital role in maintaining cellular homeostasis and drug metabolism.
Verified Bioactivity
The enzyme activity is measured by its ability to cleave substrate 4-NPA, The Km is 1.198 - 2.303 mM.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P23953 (H19-H550)
-
Gene ID13884 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
CES1C (H19-H550)
Accession # P23953 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Carboxylesterase 1C; EC:3.1.1.1; Liver carboxylesterase N; Lung surfactant convertase; PES-N; Ces1c; Es1
-
AA Sequence
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
-
Predicted Molecular Mass
60.6 kDa
-
Molecular Weight
Approximately 70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
