Carboxylesterase 1C Protein, Mouse (P.pastoris, His)

The carboxylesterase 1C protein is essential for xenobiotic detoxification and ester/amide prodrug activation, as well as participating in extracellular metabolism. Its multifunctional effects include processing of pulmonary surfactant. Carboxylesterase 1C Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Carboxylesterase 1C protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Carboxylesterase 1C Protein, Mouse (P.pastoris, His) is 532 a.a., with molecular weight of ~60.6 kDa.

The Carboxylesterase 1C Protein plays a crucial role in the detoxification of xenobiotics and the activation of ester and amide prodrugs. This versatile enzyme is actively engaged in extracellular metabolism, particularly contributing to the processing of lung surfactant. Its involvement in both xenobiotic metabolism and prodrug activation underscores its significance in cellular defense mechanisms and therapeutic interventions. The dual functions of Carboxylesterase 1C highlight its ability to modulate the bioavailability of drugs and facilitate the breakdown of foreign substances, illustrating its vital role in maintaining cellular homeostasis and drug metabolism.

The enzyme activity is measured by its ability to cleave substrate 4-NPA, The Km is 1.198 - 2.303 mM.

Mouse

P. pastoris

N-6*His

P23953 (H19-H550)

13884  [NCBI]

HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH

Approximately 60.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.