1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. CDNF/MANF family
  5. Cardiotrophin-1/CTF1 Protein, Human (CHO)

Cardiotrophin-1/CTF1 Protein, Human (CHO)

Cat. No.: HY-P7149
Handling Instructions

Cardiotrophin-1/CTF1 Protein, Human (CHO), a member of IL-6 family of cytokines, is a key regulator of energy homeostasis and of glucose and lipid metabolism.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $660 Get quote
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

CHO

Tag

Tag Free

Accession

Q16619 (S2-A201)

Gene ID

1489

Synonyms
rHuCT-1; CTF1
AA Sequence

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Molecular Weight

24-26 kDa

Biological Activity
The ED50 is <0.4 ng/mL as measured by TF-1 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Cardiotrophin (CT)-1 belongs to the IL-6 family of cytokines[1]. Cardiotrophin-1 (CT1) plays an important role in the differentiation, development, and survival of neural stem cells. CT1 plays a key role in neural tissue development and has survival-promoting, anti-apoptotic effects in neural injury or death. CT1 induces a phenotypic switch in sympathetic neurons and promotes the survival of dopaminergic neurons from the central nervous system and ciliary neurons from the periphery[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cardiotrophin-1/CTF1 Protein, Human (CHO)
Cat. No.:
HY-P7149
Quantity:
MCE Japan Authorized Agent: