Cathepsin L2 Protein, Human (HEK293, His, solution)
Based on 1 Customer Validation
Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Cathepsin L2, a cysteine protease, is anticipated to hold a significant role in corneal physiology. The precise functions and mechanisms of action associated with this protease in corneal processes are subjects of ongoing investigation. The distinct properties of Cathepsin L2 suggest its potential involvement in critical cellular and molecular events within the cornea, emphasizing its importance in maintaining the health and functionality of this ocular tissue. Further research is warranted to elucidate the specific contributions and regulatory pathways through which Cathepsin L2 influences corneal physiology.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
O60911 (V18-V334)
-
Molecular Construction
-
N-term
-
Cathepsin L2 (V18-V334)
Accession # O60911 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
CTSV; Cathepsin L2; Prev. CTSL2; CATL2; CTSU; Cathepsin L2, Preproprotein; Cathepsin V; Cathepsin U
-
AA Sequence
VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
-
Predicted Molecular Mass
36.7 kDa
-
Molecular Weight
Approximately 33-43 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
