Cathepsin L2 Protein, Human (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cathepsin L2 is a cysteine protease thought to play a crucial role in corneal physiology, but its specific function and mechanism are still under investigation. The unique properties of cathepsin L2 suggest that it may be involved in important cellular and molecular events within the cornea, underscoring its importance in maintaining ocular tissue health. Cathepsin L2 Protein, Human (HEK293, His, solution) is the recombinant human-derived Cathepsin L2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Cathepsin L2, a cysteine protease, is anticipated to hold a significant role in corneal physiology. The precise functions and mechanisms of action associated with this protease in corneal processes are subjects of ongoing investigation. The distinct properties of Cathepsin L2 suggest its potential involvement in critical cellular and molecular events within the cornea, emphasizing its importance in maintaining the health and functionality of this ocular tissue. Further research is warranted to elucidate the specific contributions and regulatory pathways through which Cathepsin L2 influences corneal physiology.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Cathepsin L2 (V18-V334)
      Accession # O60911
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein (with Propeptide)

  • Synonyms

    CTSV; Cathepsin L2; Prev. CTSL2; CATL2; CTSU; Cathepsin L2, Preproprotein; Cathepsin V; Cathepsin U

  • AA Sequence

    VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV

  • Predicted Molecular Mass

    36.7 kDa

  • Molecular Weight

    Approximately 33-43 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00