CD200R1 Protein, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of CD200R1 Protein, Mouse (HEK293, His) is 213 a.a., with molecular weight of 55-65 kDa.

CD200R1 protein functions as an inhibitory receptor for the CD200/OX2 cell surface glycoprotein, playing a pivotal role in regulating inflammatory responses. Its inhibitory action manifests by suppressing the expression of pro-inflammatory molecules such as TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to specific stimuli. The interaction between CD200 and CD200R1 is mediated through their respective N-terminal Ig-like domains, highlighting a key molecular mechanism through which this receptor contributes to the modulation of inflammatory processes.

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD200, at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse CD200R1 protein. The ED₅₀ for this effect is 57.28 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse CD200, at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse CD200R1 protein. The ED₅₀ for this effect is 57.28 ng/mL。

Mouse

HEK293

C-His;C-6*His

Q9ES57/NP_067300.1 (T26-P238)

57781  [NCBI]

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

55-65 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.The protein migrates as a 55-65 kDa band under reducing SDS-PAGE due to glycosylation.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.