1. Recombinant Proteins
  2. Immune Checkpoint Proteins Receptor Proteins
  3. Stimulatory Immune Checkpoint Molecules
  4. CD200R
  5. CD200R1
  6. CD200R1 Protein, Mouse (HEK293, His)

CD200R1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P75625
SDS COA Handling Instructions

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of CD200R1 Protein, Mouse (HEK293, His) is 213 a.a., with molecular weight of 55-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of CD200R1 Protein, Mouse (HEK293, His) is 213 a.a., with molecular weight of 55-65 kDa.

Background

CD200R1 protein functions as an inhibitory receptor for the CD200/OX2 cell surface glycoprotein, playing a pivotal role in regulating inflammatory responses. Its inhibitory action manifests by suppressing the expression of pro-inflammatory molecules such as TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to specific stimuli. The interaction between CD200 and CD200R1 is mediated through their respective N-terminal Ig-like domains, highlighting a key molecular mechanism through which this receptor contributes to the modulation of inflammatory processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD200, at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse CD200R1 protein. The ED50 for this effect is 57.28 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-His;C-6*His

Accession

Q9ES57/NP_067300.1 (T26-P238)

Gene ID
Molecular Construction
N-term
CD200R1 (T26-P238)
Accession # Q9ES57/NP_067300.1
His
C-term
Synonyms
Cell surface glycoprotein CD200 receptor 1; CD200R; CRTR2; MOX2R; OX2R
AA Sequence

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Weight

55-65 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.The protein migrates as a 55-65 kDa band under reducing SDS-PAGE due to glycosylation.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD200R1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD200R1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75625
Quantity:
MCE Japan Authorized Agent: