CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc)
Based on 1 Customer Validation
CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.
Background
The CD27/NFRSF7 Protein serves as a receptor for CD70/CD27L and is implicated in the survival of activated T-cells. Additionally, it may play a role in apoptosis by interacting with SIVA1. The protein forms homodimers and engages with SIVA1 and TRAF2, suggesting its involvement in diverse cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc;C-6*His
-
Accession
P41272 (P24-R182)
-
Molecular Construction
-
N-term
-
CD27 (P24-R182)
Accession # P41272 -
hFc-6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD27; T-Cell Activation Antigen CD27; Prev. TNFRSF7; T14; CD27 Antigen; Tumor Necrosis Factor Receptor Superfamily Member 7; S152; T-Cell Activation Antigen S152; Tp55; T Cell Activation Antigen S152; Tumor Necrosis Factor Receptor Superfamily, Member 7;
-
AA Sequence
PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
-
Predicted Molecular Mass
45.8 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
