CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc)

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1. It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes. CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is 159 a.a., with molecular weight of 60-66 kDa.

The CD27/NFRSF7 Protein serves as a receptor for CD70/CD27L and is implicated in the survival of activated T-cells. Additionally, it may play a role in apoptosis by interacting with SIVA1. The protein forms homodimers and engages with SIVA1 and TRAF2, suggesting its involvement in diverse cellular processes.

Mouse

HEK293

C-hFc;C-6*His

P41272 (P24-R182)

21940  [NCBI]

PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

60-66 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.