CD38 Protein, Cynomolgus (HEK293, His)

The CD38 protein plays multifaceted roles in cell signaling and is critical for the synthesis of cyclic ADP-ribose (cADPR) as a possible second messenger in glucose-induced insulin secretion. CD38 also promotes calcium mobilization through the synthesis of niacin adenine dinucleotide phosphate (NAADP+) and exhibits cADPR hydrolase activity. CD38 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD38 Protein, Cynomolgus (HEK293, His) is 258 a.a., with molecular weight of 38-50 kDa.

The CD38 protein assumes a multifaceted role in cellular signaling, playing a pivotal part in the synthesis of cyclic ADP-ribose (cADPR), identified as a probable second messenger crucial for glucose-induced insulin secretion. Additionally, CD38 contributes to calcium mobilization by synthesizing nicotinate-adenine dinucleotide phosphate, NAADP(+), derived from 2'-phospho-cADPR and nicotinic acid, as well as from NADP(+) and nicotinic acid. Beyond its synthetic functions, CD38 exhibits cADPR hydrolase activity, suggesting its involvement in the dynamic regulation of these signaling molecules. This intricate repertoire of activities underscores the central role CD38 plays in mediating crucial cellular responses, particularly in the context of insulin secretion and calcium mobilization.

Cynomolgus

HEK293

C-6*His

Q5VAN0 (L44-I301)

102126394  [NCBI]

LPRWRQQWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAFKGAFISKYPCNITEEDYQPLVKLGTQTVPCNKTLLWSRIKDLAHQFTQVQRDMFTLEDMLLGYLADDLTWCGEFNTFEINYQSCPDWRKDCSNNPVSVFWKTVSRRFAETACGVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQALEAWVIHGGREDSRDLCQDPTIKELESIISKRNIRFFCKNIYRPDKFLQCVKNPEDSSCLSGI

38-50 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.