1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Human (193a.a, HEK293, C-His)

CD40 Protein, Human (193a.a, HEK293, C-His)

Cat. No.: HY-P73499A
COA Handling Instructions

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (193a.a, HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD40 Protein, Human (193a.a, HEK293, C-His) is 173 a.a., with molecular weight of ~28-32 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $30 In-stock
10 μg $55 In-stock
50 μg $110 In-stock
100 μg $170 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (193a.a, HEK293, C-His) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD40 Protein, Human (193a.a, HEK293, C-His) is 173 a.a., with molecular weight of ~28-32 kDa.

Background

CD40 Protein, acting as the receptor for TNFSF5/CD40LG, is instrumental in transducing signals through TRAF6- and MAP3K8-mediated pathways, leading to the activation of ERK in macrophages and B cells and subsequent induction of immunoglobulin secretion. Existing in both monomeric and homodimeric forms, CD40 Protein exhibits variations in its homodimeric structure, as observed in the bladder carcinoma cell line Hu549. The receptor interacts with key signaling molecules such as TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, with the crucial interaction occurring between CD40 Protein, TRAF6, and MAP3K8, thereby playing a pivotal role in ERK activation.

Biological Activity

1. Measured in a cell proliferation assay using human B cells (Ramos). in the presence of 10 ng/mL Human IL-4. The ED50 this effect is 0.1268 ng/mL, corresponding to a specific activity is 7.886×106 units/mg.
2. Measured by its binding ability in a functional ELISA. Immobilized human CD40 at 2 μg/mL (100 μL/well) can bind human CD40L with a linear range of 15.6-500 ng/mL.

  • Measured in a cell proliferation assay using human B cells (Ramos). in the presence of 10ng/mL Human IL-4. The ED50 for this effect is 0.1268 ng/mL, corresponding to a specific activity is 7.886×106 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P25942 (E21-R193)

Gene ID

958  [NCBI]

Molecular Construction
N-term
CD40 (E21-R193)
Accession # P25942
6*His
C-term
Synonyms
Tumor Necrosis Factor Receptor Superfamily member 5; Bp50; CD40L Receptor; CDw40; TNFRSF5
AA Sequence

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Weight

Approximately 28-32 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Human (193a.a, HEK293, C-His)
Cat. No.:
HY-P73499A
Quantity:
MCE Japan Authorized Agent: