1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Rhesus Macaque (HEK293, His)

CD40 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P75408
COA Handling Instructions

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD40 Protein, Rhesus Macaque (HEK293, His) is 173 a.a., with molecular weight of ~31.67 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $60 In-stock
50 μg $160 In-stock
100 μg $270 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD40 Protein, Rhesus Macaque (HEK293, His) is 173 a.a., with molecular weight of ~31.67 kDa.

Background

CD40, a crucial member of the TNFR superfamily, is characterized by the absence of conserved residue(s) necessary for the propagation of feature annotation. This distinctive feature suggests unique structural attributes in CD40, potentially influencing its functional interactions within the TNFR superfamily. The lack of these conserved residues underscores the specific nature of CD40 and emphasizes the importance of further exploration to unravel its distinct roles and regulatory mechanisms in cellular signaling pathways.

Biological Activity

Immobilized Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Biotinylated Rhesus macaque CD40. The ED50 for this effect is 6.431 ng/mL, corresponding to a specific activity is 1.55×10^5 Unit/mg.

  • Immobilized Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Biotinylated Rhesus macaque CD40. The ED50 for this effect is 6.431 ng/mL, corresponding to a specific activity is 1.55×105 Unit/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-10*His

Accession

NP_001252791.1 (E21-R193)

Gene ID

707749  [NCBI]

Molecular Construction
N-term
CD40 (E21-R193)
Accession # NP_001252791.1
10*His
C-term
Synonyms
Tumor Necrosis Factor Receptor Superfamily member 5; Bp50; CD40L Receptor; CDw40; TNFRSF5
AA Sequence

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

Molecular Weight

Approximately 31.67 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P75408
Quantity:
MCE Japan Authorized Agent: