Copy Link Print Information

CD40 Protein, Rhesus Macaque (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD40 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for CD40 Protein, Rhesus Macaque (HEK293, His)
  • CD40 Protein, Rhesus Macaque (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

CD40, a crucial member of the TNFR superfamily, is characterized by the absence of conserved residue(s) necessary for the propagation of feature annotation. This distinctive feature suggests unique structural attributes in CD40, potentially influencing its functional interactions within the TNFR superfamily. The lack of these conserved residues underscores the specific nature of CD40 and emphasizes the importance of further exploration to unravel its distinct roles and regulatory mechanisms in cellular signaling pathways.

Verified Bioactivity

Immobilized Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Biotinylated Rhesus macaque CD40. The ED50 for this effect is 6.431 ng/mL, corresponding to a specific activity is 1.55×10^5 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Biotinylated Rhesus macaque CD40. The ED50 for this effect is 6.431 ng/mL, corresponding to a specific activity is 1.55×105 Unit/mg.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-10*His
  • Accession

    NP_001252791.1 (E21-R193)

  • Gene ID
    707749  [NCBI]
  • Molecular Construction
    • N-term
    • CD40 (E21-R193)
      Accession # NP_001252791.1
    • 10*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily

  • AA Sequence

    EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

  • Molecular Weight

    Approximately 30-34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human CD40 Ligand at 2 μg/mL (100 μL/well) can bind Biotinylated Rhesus macaque CD40. The ED50 for this effect is 6.431 ng/mL, corresponding to a specific activity is 1.55×105 Unit/mg.

  • CD40 Protein, Rhesus Macaque (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD40 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for CD40 Protein, Rhesus Macaque (HEK293, His)
  • CD40 Protein, Rhesus Macaque (HEK293, His) Product Image