1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins B Cell CD Proteins Dendritic Cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD5
  5. CD5 Protein, Rhesus Macaque (HEK293, His)

CD5 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P77618A
COA Handling Instructions

CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD5 Protein, Rhesus Macaque (HEK293, His) is 351 a.a., with molecular weight of approximately 41.81 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $47 In-stock
10 μg $80 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD5 Protein, Rhesus Macaque (HEK293, His) is 351 a.a., with molecular weight of approximately 41.81 kDa.

Background

The CD5 protein is distinguished by its deficiency in conserved residue(s) crucial for the propagation of feature annotation.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Zymosan at 200 μg/mL (100 μL/well) can bind Biotinylated CD5. The ED50 for this effect is 1.68 μg/mL, corresponding to a specific activity is 595.24 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Zymosan at 200 μg/mL (100 μL/well) can bind Biotinylated CD5. The ED50 for this effect is 1.68 μg/mL, corresponding to a specific activity is 595.24 Unit/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

F6V5Q9 (R25-P375)

Gene ID

/

Molecular Construction
N-term
CD5 (R25-P375)
Accession # F6V5Q9
6*His
C-term
Synonyms
CD5 molecule; CD5; LEU1; T1; CD5 antigen
AA Sequence

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Weight

approximately 41.81 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD5 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77618A
Quantity:
MCE Japan Authorized Agent: