Copy Link Print Information

CD82 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CD82, a vital immune response participant, engages with CD4 or CD8 to provide crucial costimulatory signals in the TCR/CD3 pathway. Its direct interaction with IGSF8 plays a pivotal role in modulating immune functions and mediating cellular responses. CD82 Protein, Human (HEK293, Fc) is the recombinant human-derived CD82 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD82 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD82, a vital immune response participant, engages with CD4 or CD8 to provide crucial costimulatory signals in the TCR/CD3 pathway. Its direct interaction with IGSF8 plays a pivotal role in modulating immune functions and mediating cellular responses. CD82 Protein, Human (HEK293, Fc) is the recombinant human-derived CD82 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

As a critical participant in immune responses, CD82 associates with CD4 or CD8, delivering essential costimulatory signals within the TCR/CD3 pathway. Through direct interaction with IGSF8, CD82 plays a pivotal role in modulating immune functions and mediating cellular responses.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession

    P27701-1 (G103-Q225)

  • Gene ID
    3732  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • CD82 (G103-Q225)
      Accession # P27701-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD82; Tetraspanin-27; Prev. KAI1; Tspan-27; Prev. ST6; SAR2; TSPAN27; Suppressor Of Tumorigenicity 6 Protein; IA4; Suppression Of Tumorigenicity 6; CD82 Antigen; R2 Leukocyte Antigen; R2; GR15; Kangai 1 (Suppression Of Tumorigenicity 6, Prostate; CD82 Ant

  • AA Sequence

    GALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQ

  • Predicted Molecular Mass

    40.3 kDa

  • Molecular Weight

    Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD82 Protein, Human (HEK293, Fc) Product Image
    1/16
  • CD82 Protein, Human (HEK293, Fc) Product Image