CD84/SLAMF5 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

CD84, a member of the signaling lymphocytic activation molecule (SLAM) family, functions as a self-ligand receptor involved in the intricate regulation of immune responses. Through homo- or heterotypic cell-cell interactions, SLAM receptors, including CD84, modulate the activation and differentiation of diverse immune cells, contributing to the coordination of both innate and adaptive immune responses. The activities of CD84 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, such as SH2D1A/SAP and SH2D1B/EAT-2. CD84 plays a role in natural killer (NK) cell cytotoxicity, T-cell proliferation, interferon gamma (IFNG) secretion, platelet stimulation, and is implicated as a marker for hematopoietic progenitor cells. Furthermore, CD84 is essential for T-cell:B-cell interactions, optimal T follicular helper function, germinal center formation, and maintenance of B cell tolerance in germinal centers, preventing autoimmunity. In mast cells, CD84 negatively regulates high-affinity immunoglobulin epsilon receptor signaling, while in macrophages, it positively regulates LPS-induced MAPK phosphorylation and NF-kappaB activation. Additionally, CD84 plays a role in enhancing macroautophagy in primary dendritic cells by stabilizing IRF8. CD84 forms homodimers via its extracellular domain and engages in head-to-tail dimers with CD48 molecules from other cells. It interacts with various proteins, including SH2 domain-containing proteins, tyrosine-protein phosphatases, and is subject to complex regulatory mechanisms involving phosphorylation and adapter proteins.

Verified Bioactivity

Measured in a cell proliferation assay using PHA stimulated Mouse T cells in the presence of anti-CD3. The ED50 for this effect is 0.5203 µg/mL in the presence of anti-CD3 immobilized at 20 ng/mL, corresponding to a specific activity is 1.922×10^3 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using PHA stimulated Mouse T cells in the presence of anti-CD3. The ED50 for this effect is 0.5203 µg/mL in the presence of anti-CD3 immobilized at 20 ng/mL, corresponding to a specific activity is 1.922×103 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD84 (K22-V221)
      Accession # Q18PI6-1
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD84; Cell Surface Antigen MAX.3; CD84 Molecule; SLAM Family Member 5; SLAMF5; Hly9-Beta; HCD84; Alternative Protein CD84; MCD84; Leukocyte Antigen CD84; Signaling Lymphocytic Activation Molecule 5; Leucocyte Differentiation Antigen CD84; CD84 Antigen; Le

  • AA Sequence

    KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV

  • Predicted Molecular Mass

    23.9 kDa

  • Molecular Weight

    Approximately 32-37 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00