CD84/SLAMF5 Protein, Mouse (221a.a, HEK293, C-His)

CD84/SLAMF5, a self-ligand receptor of the SLAM family, modulates immune cell activation and differentiation through homo- or heterotypic interactions. Its activities are influenced by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 plays roles in NK cell cytotoxicity, T-cell proliferation, interferon gamma secretion, platelet stimulation, hematopoietic progenitor cell marking, and germinal center functions. It contributes to B cell tolerance, prevents autoimmunity, regulates mast cell signaling, and enhances macrophage responses. The protein forms homodimers and interacts with various signaling molecules. CD84/SLAMF5 Protein, Mouse (221a.a, HEK293, C-His) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD84/SLAMF5 Protein, Mouse (221a.a, HEK293, C-His) is 200 a.a., with molecular weight of 32-37 kDa.

CD84, a member of the signaling lymphocytic activation molecule (SLAM) family, functions as a self-ligand receptor involved in the intricate regulation of immune responses. Through homo- or heterotypic cell-cell interactions, SLAM receptors, including CD84, modulate the activation and differentiation of diverse immune cells, contributing to the coordination of both innate and adaptive immune responses. The activities of CD84 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, such as SH2D1A/SAP and SH2D1B/EAT-2. CD84 plays a role in natural killer (NK) cell cytotoxicity, T-cell proliferation, interferon gamma (IFNG) secretion, platelet stimulation, and is implicated as a marker for hematopoietic progenitor cells. Furthermore, CD84 is essential for T-cell:B-cell interactions, optimal T follicular helper function, germinal center formation, and maintenance of B cell tolerance in germinal centers, preventing autoimmunity. In mast cells, CD84 negatively regulates high-affinity immunoglobulin epsilon receptor signaling, while in macrophages, it positively regulates LPS-induced MAPK phosphorylation and NF-kappaB activation. Additionally, CD84 plays a role in enhancing macroautophagy in primary dendritic cells by stabilizing IRF8. CD84 forms homodimers via its extracellular domain and engages in head-to-tail dimers with CD48 molecules from other cells. It interacts with various proteins, including SH2 domain-containing proteins, tyrosine-protein phosphatases, and is subject to complex regulatory mechanisms involving phosphorylation and adapter proteins.

Measured in a cell proliferation assay using PHA stimulated Mouse T cells in the presence of anti-CD3. The ED₅₀ for this effect is 0.5203 µg/mL in the presence of anti-CD3 immobilized at 20 ng/mL, corresponding to a specific activity is 1.922×10^3 units/mg.

• 
  Measured in a cell proliferation assay using PHA stimulated Mouse T cells in the presence of anti-CD3. The ED₅₀ for this effect is 0.5203 µg/mL in the presence of anti-CD3 immobilized at 20 ng/mL, corresponding to a specific activity is 1.922×10³ units/mg.

Mouse

HEK293

C-10*His

Q18PI6-1 (K22-V221)

12523

KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV

32-37 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.