1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. DRAP-27/CD9
  5. CD9 Protein, Mouse (Cell-Free, His)

CD9 Protein, Mouse (Cell-Free, His)

Cat. No.: HY-P702243
COA Handling Instructions

The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CD9 Protein, Mouse (Cell-Free, His) is 226 a.a., with molecular weight of 28.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $500 In-stock
50 μg $1000 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CD9 Protein, Mouse (Cell-Free, His) is 226 a.a., with molecular weight of 28.1 kDa.

Background

The CD9 protein, an integral membrane protein associated with integrins, plays a pivotal role in regulating various processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. It is prominently present on the cell surface of oocytes, where it assumes a key role in sperm-egg fusion, potentially by orchestrating multiprotein complexes and influencing membrane morphology essential for the fusion process. In myoblasts, CD9 associates with CD81 and PTGFRN, acting as an inhibitor of myotube fusion during muscle regeneration. Within macrophages, CD9 forms associations with CD9 and beta-1 and beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles and impeding the fusion between mononuclear cell progenitors into osteoclasts responsible for bone resorption. CD9 also acts as a receptor for PSG17 and is involved in platelet activation and aggregation, regulating paranodal junction formation. Its role extends to cell adhesion, cell motility, and tumor metastasis, particularly influencing integrin-dependent migration of macrophages, a critical aspect of the inflammatory response in the lung. CD9 forms disulfide-linked homodimers, higher homooligomers, and heterooligomers with other tetraspanin family members. It interacts with integrins ITGAV:ITGB3 and ITGA6:ITGB1, forming complexes with CD81, beta-1, and beta-2 integrins, CD63, CR2/CD21, PTGFRN/CD9P1, and IGSF8, the latter interaction being direct. Additionally, CD9's interaction with PDPN is homophilic and attenuates platelet aggregation and pulmonary metastasis induced by PDPN.

Species

Mouse

Source

E. coli Cell-free

Tag

N-10*His

Accession

P40240 (M1-V226)

Gene ID

12527

Molecular Construction
N-term
10*His
CD9 (M1-V226)
Accession # P40240
C-term
Synonyms
CD9 antigen
AA Sequence

MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Molecular Weight

28.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD9 Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702243
Quantity:
MCE Japan Authorized Agent: