CD9 Protein, Mouse (Cell-Free, His)

Customer Review

Based on 1 Customer Validation

The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

The CD9 protein, an integral membrane protein associated with integrins, plays a pivotal role in regulating various processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. It is prominently present on the cell surface of oocytes, where it assumes a key role in sperm-egg fusion, potentially by orchestrating multiprotein complexes and influencing membrane morphology essential for the fusion process. In myoblasts, CD9 associates with CD81 and PTGFRN, acting as an inhibitor of myotube fusion during muscle regeneration. Within macrophages, CD9 forms associations with CD9 and beta-1 and beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles and impeding the fusion between mononuclear cell progenitors into osteoclasts responsible for bone resorption. CD9 also acts as a receptor for PSG17 and is involved in platelet activation and aggregation, regulating paranodal junction formation. Its role extends to cell adhesion, cell motility, and tumor metastasis, particularly influencing integrin-dependent migration of macrophages, a critical aspect of the inflammatory response in the lung. CD9 forms disulfide-linked homodimers, higher homooligomers, and heterooligomers with other tetraspanin family members. It interacts with integrins ITGAV:ITGB3 and ITGA6:ITGB1, forming complexes with CD81, beta-1, and beta-2 integrins, CD63, CR2/CD21, PTGFRN/CD9P1, and IGSF8, the latter interaction being direct. Additionally, CD9's interaction with PDPN is homophilic and attenuates platelet aggregation and pulmonary metastasis induced by PDPN.

Technical Parameters

  • Species Mouse
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • CD9 (M1-V226)
      Accession # P40240
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CD9; CD9 Antigen (P24); Prev. MIC3; BA2; TSPAN29; Motility-Related Protein; MRP-1; BA-2/P24 Antigen; Tetraspanin-29; Antigen CD9; CD9 Antigen; Tetraspanin; P24; TSPAN-29; Cell Growth-Inhibiting Gene 2 Protein; Tspan-29; Motility Related Protein-1; DRAP-27

  • AA Sequence

    MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

  • Predicted Molecular Mass

    28.1 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00