CD9 Protein, Mouse (Cell-Free, His)
Based on 1 Customer Validation
The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The CD9 protein is an integrin-linked integral membrane protein that regulates sperm-egg fusion, platelet activation, and cell adhesion. On oocytes, it promotes sperm-egg fusion by organizing multi-protein complexes. CD9 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CD9 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
The CD9 protein, an integral membrane protein associated with integrins, plays a pivotal role in regulating various processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. It is prominently present on the cell surface of oocytes, where it assumes a key role in sperm-egg fusion, potentially by orchestrating multiprotein complexes and influencing membrane morphology essential for the fusion process. In myoblasts, CD9 associates with CD81 and PTGFRN, acting as an inhibitor of myotube fusion during muscle regeneration. Within macrophages, CD9 forms associations with CD9 and beta-1 and beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles and impeding the fusion between mononuclear cell progenitors into osteoclasts responsible for bone resorption. CD9 also acts as a receptor for PSG17 and is involved in platelet activation and aggregation, regulating paranodal junction formation. Its role extends to cell adhesion, cell motility, and tumor metastasis, particularly influencing integrin-dependent migration of macrophages, a critical aspect of the inflammatory response in the lung. CD9 forms disulfide-linked homodimers, higher homooligomers, and heterooligomers with other tetraspanin family members. It interacts with integrins ITGAV:ITGB3 and ITGA6:ITGB1, forming complexes with CD81, beta-1, and beta-2 integrins, CD63, CR2/CD21, PTGFRN/CD9P1, and IGSF8, the latter interaction being direct. Additionally, CD9's interaction with PDPN is homophilic and attenuates platelet aggregation and pulmonary metastasis induced by PDPN.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P40240 (M1-V226)
-
Gene ID12527
-
Molecular Construction
-
N-term
-
10*His
-
CD9 (M1-V226)
Accession # P40240 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CD9; CD9 Antigen (P24); Prev. MIC3; BA2; TSPAN29; Motility-Related Protein; MRP-1; BA-2/P24 Antigen; Tetraspanin-29; Antigen CD9; CD9 Antigen; Tetraspanin; P24; TSPAN-29; Cell Growth-Inhibiting Gene 2 Protein; Tspan-29; Motility Related Protein-1; DRAP-27
-
AA Sequence
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
-
Predicted Molecular Mass
28.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)