CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His)
CD93/C1qR1 Protein lacks conserved residue(s) crucial for feature annotation propagation. CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His) is the recombinant cynomolgus-derived CD93/C1qR1 protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD93/C1qR1 Protein lacks conserved residue(s) crucial for feature annotation propagation. CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His) is the recombinant cynomolgus-derived CD93/C1qR1 protein, expressed by HEK293 , with C-10*His labeled tag.
Background
The CD93/C1qR1 protein is characterized by a deficiency in conserved residue(s) crucial for the propagation of feature annotation.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-10*His
-
Accession
A0A2K5VH53 (A24-L581)
-
Molecular Construction
-
N-term
-
C1qR1 (A24-L581)
Accession # A0A2K5VH53 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD93; DJ737E23.1; Prev. C1QR1; ECSM3; Prev. MXRA4; Matrix-Remodeling-Associated Protein 4; C1qR(P); Matrix-Remodelling Associated 4; CDw93; C1qR; Complement Component 1 Q Subcomponent Receptor 1; Complement Component 1, Q Subcomponent, Receptor 1; Complem
-
AA Sequence
ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL
-
Predicted Molecular Mass
60.2 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
