Copy Link Print Information

CDTB Protein, E.coli (Myc, His-SUMO)

Customer Review

Based on 1 Customer Validation

CDTB Protein, integral to the tripartite complex for Cytolethal Distending Toxin (CDT) activity, features DNA-nicking endonuclease action, likely causing DNA damage. This damage prompts G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. Collaborating with CdtA and CdtC, CDTB forms a crucial unit for CDT's cytotoxic effects, showcasing its multifaceted role in cellular responses to CDT intoxication. CDTB Protein, E.coli (Myc, His-SUMO) is the recombinant E. coli-derived CDTB protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CDTB Protein, E.coli (Myc, His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CDTB Protein, integral to the tripartite complex for Cytolethal Distending Toxin (CDT) activity, features DNA-nicking endonuclease action, likely causing DNA damage. This damage prompts G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. Collaborating with CdtA and CdtC, CDTB forms a crucial unit for CDT's cytotoxic effects, showcasing its multifaceted role in cellular responses to CDT intoxication. CDTB Protein, E.coli (Myc, His-SUMO) is the recombinant E. coli-derived CDTB protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

CDTB Protein is an integral component of the tripartite complex essential for Cytolethal Distending Toxin (CDT) activity. With its distinct DNA-nicking endonuclease activity, CdtB is likely responsible for inducing DNA damage in targeted cells. This damage, in turn, triggers G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. CDTB functions within the heterotrimeric assembly alongside CdtA and CdtC, forming a cohesive unit critical for the cytotoxic effects of CDT. The intricate interplay of these subunits underscores the multifaceted role of CDTB in cellular responses to CDT intoxication.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-His;C-Myc;N-SUMO
  • Accession

    Q46669 (D19-R269)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • 10*His-SUMO
    • CDTB (D19-R269)
      Accession # Q46669
    • Myc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Cytolethal distending toxin subunit B; CDT B; Deoxyribonuclease CdtB; EC:3.1.-.-; cdtB

  • AA Sequence

    DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR

  • Predicted Molecular Mass

    47.4 kDa

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CDTB Protein, E.coli (Myc, His-SUMO) Product Image
    1/16
  • CDTB Protein, E.coli (Myc, His-SUMO) Product Image