CDTB Protein, E.coli (Myc, His-SUMO)

CDTB Protein, integral to the tripartite complex for Cytolethal Distending Toxin (CDT) activity, features DNA-nicking endonuclease action, likely causing DNA damage. This damage prompts G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. Collaborating with CdtA and CdtC, CDTB forms a crucial unit for CDT's cytotoxic effects, showcasing its multifaceted role in cellular responses to CDT intoxication. CDTB Protein, E.coli (Myc, His-SUMO) is the recombinant E. coli-derived CDTB protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag. The total length of CDTB Protein, E.coli (Myc, His-SUMO) is 251 a.a., with molecular weight of ~47.4 kDa.

CDTB Protein is an integral component of the tripartite complex essential for Cytolethal Distending Toxin (CDT) activity. With its distinct DNA-nicking endonuclease activity, CdtB is likely responsible for inducing DNA damage in targeted cells. This damage, in turn, triggers G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. CDTB functions within the heterotrimeric assembly alongside CdtA and CdtC, forming a cohesive unit critical for the cytotoxic effects of CDT. The intricate interplay of these subunits underscores the multifaceted role of CDTB in cellular responses to CDT intoxication.

E.coli

E. coli

N-His;C-Myc;N-SUMO

Q46669 (19D-269R)

/

DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR

Approximately 47.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.