CDTB Protein, E.coli (Myc, His-SUMO)

CDTB Protein, integral to the tripartite complex for Cytolethal Distending Toxin (CDT) activity, features DNA-nicking endonuclease action, likely causing DNA damage. This damage prompts G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. Collaborating with CdtA and CdtC, CDTB forms a crucial unit for CDT's cytotoxic effects, showcasing its multifaceted role in cellular responses to CDT intoxication. CDTB Protein, E.coli (Myc, His-SUMO) is the recombinant E. coli-derived CDTB protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

CDTB Protein is an integral component of the tripartite complex essential for Cytolethal Distending Toxin (CDT) activity. With its distinct DNA-nicking endonuclease activity, CdtB is likely responsible for inducing DNA damage in targeted cells. This damage, in turn, triggers G2/M cell cycle arrest, chromatin fragmentation, cell distention, and nucleus enlargement. CDTB functions within the heterotrimeric assembly alongside CdtA and CdtC, forming a cohesive unit critical for the cytotoxic effects of CDT. The intricate interplay of these subunits underscores the multifaceted role of CDTB in cellular responses to CDT intoxication.

E.coli

E. coli

N-His;C-Myc;N-SUMO

Q46669 (D19-R269)

/

Full Length of Mature Protein

DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR

Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.