Chymase/CMA1 Protein, Mouse (His)

Chymase/CMA1 Protein, a prominent secreted protease in mast cells, is implicated in various physiological processes, including the generation of vasoactive peptides, extracellular matrix degradation, and the regulation of gland secretion. Chymase/CMA1 Protein, Mouse (His) is the recombinant mouse-derived Chymase/CMA1 protein, expressed by E. coli , with N-His labeled tag. The total length of Chymase/CMA1 Protein, Mouse (His) is 225 a.a., with molecular weight of ~29.2 kDa.

Chymase/CMA1 Protein emerges as the principal secreted protease in mast cells, suggesting involvement in vasoactive peptide generation, extracellular matrix degradation, and the regulation of gland secretion.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

E. coli

N-His

P21844 (I22-E246)

17228  [NCBI]

IGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREN

Approximately 29.2kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

<23 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.