Chymase/CMA1 Protein, Mouse (His)
Based on 1 Customer Validation
Chymase/CMA1 Protein, a prominent secreted protease in mast cells, is implicated in various physiological processes, including the generation of vasoactive peptides, extracellular matrix degradation, and the regulation of gland secretion.Chymase/CMA1 Protein, Mouse (His) is the recombinant mouse-derived Chymase/CMA1 protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Chymase/CMA1 Protein, a prominent secreted protease in mast cells, is implicated in various physiological processes, including the generation of vasoactive peptides, extracellular matrix degradation, and the regulation of gland secretion.Chymase/CMA1 Protein, Mouse (His) is the recombinant mouse-derived Chymase/CMA1 protein, expressed by E.coli , with N-His labeled tag.
Chymase/CMA1 Protein emerges as the principal secreted protease in mast cells, suggesting involvement in vasoactive peptide generation, extracellular matrix degradation, and the regulation of gland secretion.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P21844 (I22-E246)
-
Molecular Construction
-
N-term
-
His
-
CMA1 (I22-E246)
Accession # P21844 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CMA1; Chymase; Chymase 1; CYH; Chymase 1 Preproprotein Transcript E; Chymase, Mast Cell; Chymase 1 Preproprotein Transcript I; Chymase, Heart; Chymase 1, Mast Cell; MCT1; Mast Cell Protease I; CYM; Alpha-Chymase
-
AA Sequence
IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE
-
Predicted Molecular Mass
29.2 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<23 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
