CLDN5/Claudin-5 Protein, Rat (Cell-Free, His)

The Claudin-5/CLDN5 protein plays a key role in tightly closing the intercellular space of tight junctions and establishing direct interactions with key scaffolding proteins, including TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3. These interactions suggest an active involvement in the molecular structure of the tight junction complex. CLDN5/Claudin-5 Protein, Rat (Cell-Free, His) is the recombinant rat-derived CLDN5/Claudin-5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CLDN5/Claudin-5 Protein, Rat (Cell-Free, His) is 218 a.a., with molecular weight of 24.6 kDa.

Claudin-5 (CLDN5) assumes a pivotal role in the precise closure of the intercellular space within tight junctions. This protein establishes direct interactions with key scaffolding proteins, including TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3, suggesting its active involvement in the molecular architecture of tight junction complexes. Additionally, CLDN5 engages in interactions with MPDZ, further expanding its network of associations, and emphasizing its potential contribution to the regulation of tight junction integrity and function.

Rat

E. coli Cell-free

N-10*His

Q9JKD6 (M1-V218)

65131

MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV

24.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.