CLIC2/XAP121 Protein, Human (His)
The CLIC2/XAP121 protein exhibits the ability to insert into membranes and form chloride channels, and the activity of these channels is pH-dependent. The membrane insertion process appears to be redox-regulated and likely occurs under oxidative conditions. CLIC2/XAP121 Protein, Human (His) is the recombinant human-derived CLIC2/XAP121 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CLIC2/XAP121 protein exhibits the ability to insert into membranes and form chloride channels, and the activity of these channels is pH-dependent. The membrane insertion process appears to be redox-regulated and likely occurs under oxidative conditions. CLIC2/XAP121 Protein, Human (His) is the recombinant human-derived CLIC2/XAP121 protein, expressed by E. coli , with N-6*His labeled tag.
Background
CLIC2, also known as XAP121, is a versatile protein capable of inserting into membranes and forming chloride ion channels. The activity of these channels is pH-dependent, and membrane insertion is likely regulated by redox conditions, occurring predominantly under oxidizing conditions. Notably, CLIC2 has been found to modulate the activity of RYR2 (ryanodine receptor 2) and inhibit calcium influx, suggesting a role in calcium homeostasis. As a monomer, CLIC2 interacts with TRAPPC2 and RYR2, further emphasizing its potential involvement in diverse cellular processes and protein-protein interactions associated with membrane dynamics, ion channel regulation, and calcium signaling.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O15247 (M1-S247)
-
Molecular Construction
-
N-term
-
6*His
-
CLIC2 (M1-S247)
Accession # O15247 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CLIC2; Glutaredoxin-Like Oxidoreductase CLIC2; Chloride Intracellular Channel 2; Glutaredoxin-Like Peroxidase CLIC2; XAP121; Chloride Intracellular Channel 2 Isoform B; CLCNL2; CLIC2b; Chloride Intracellular Channel Protein 2; MRXS32
-
AA Sequence
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
-
Predicted Molecular Mass
30.5 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
