2. Recombinant Proteins
  3. Receptor Proteins
  4. CMKLR2 Protein, Rat (Cell-Free, His)

CMKLR2 Protein, Rat (Cell-Free, His)

Cat. No.: HY-P702252
Handling Instructions

CMKLR2 Protein, a receptor for chemerin/RARRES2, regulates inflammation and energy homeostasis through G proteins and MAPK1/MAPK3 pathways. It also serves as a TAFA1 receptor, impacting neuronal stem-cell processes via ROCK/ERK and ROCK/STAT3 signaling. CMKLR2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived CMKLR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CMKLR2 Protein, Rat (Cell-Free, His) is 353 a.a., with molecular weight of 42.4 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CMKLR2 Protein, a receptor for chemerin/RARRES2, regulates inflammation and energy homeostasis through G proteins and MAPK1/MAPK3 pathways. It also serves as a TAFA1 receptor, impacting neuronal stem-cell processes via ROCK/ERK and ROCK/STAT3 signaling. CMKLR2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived CMKLR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CMKLR2 Protein, Rat (Cell-Free, His) is 353 a.a., with molecular weight of 42.4 kDa.
Background

The CMKLR2 Protein functions as a receptor for the chemoattractant adipokine chemerin/RARRES2, implying its involvement in the regulation of inflammation and energy homeostasis. Operating primarily through the beta-arrestin pathway, RARRES2 binding activates G proteins, induces calcium mobilization, and triggers MAPK1/MAPK3 (ERK1/2) phosphorylation. Additionally, CMKLR2 serves as a receptor for TAFA1, facilitating TAFA1's impact on neuronal stem-cell proliferation and differentiation by activating the ROCK/ERK and ROCK/STAT3 signaling pathways.
Species

Rat
Source

E. coli Cell-free
Tag

N-10*His
Accession

P46090 (M1-Q353)
Gene ID

25457
Molecular Construction
N-term
10*His
CMKLR2 (M1-Q353)
Accession # P46090
C-term
Synonyms
Chemerin-like receptor 2; Chemerin chemokine-like receptor 2; Chemokine-like receptor 2; G-protein coupled receptor 1
AA Sequence

MEVSREMLFEELDNYSYALEYYSQEPDAEENVYPGIVHWISLLLYALAFVLGIPGNAIVIWFMGFKWKKTVTTLWFLNLAIADFVFVLFLPLYISYVALSFHWPFGRWLCKLNSFIAQLNMFSSVFFLTVISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLLGGPTLYFRDTVEVNNRIICYNNFQEYELTLMRHHVLTWVKFLFGYLLPLLTMSSCYLCLIFKTKKQNILISSKHLWMILSVVIAFMVCWTPFHLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPILYVLISKKFQARFRASVAEVLKRSLWEASCSGTVSEQLRSAETKSLSLLETAQ

Molecular Weight

42.4 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CMKLR2 Protein, Rat (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CMKLR2 Protein, Rat (Cell-Free, His)
Cat. No.:
HY-P702252
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.