Cofilin-1 Protein, Human (His)
Based on 1 Customer Validation
Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.
Background
Cofilin-1 protein exhibits pH-sensitive F-actin depolymerizing activity by binding to F-actin. In collaboration with the subcortical maternal complex (SCMC), it plays a crucial role in enabling zygotes to progress beyond the initial embryonic cell divisions through the regulation of actin dynamics. Additionally, Cofilin-1 is essential for the centralization of the mitotic spindle and symmetric division of zygotes. In epithelial cells, it contributes to the regulation of cell morphology and cytoskeletal organization. Furthermore, Cofilin-1 is required for the up-regulation of the atypical chemokine receptor ACKR2, facilitating its efficient translocation from endosomal compartments to the cell membrane, thereby enhancing chemokine uptake and degradation. Its involvement extends to neural tube morphogenesis and neural crest cell migration. Functionally, Cofilin-1 can bind G- and F-actin in a 1:1 ratio, constituting a major component of intranuclear and cytoplasmic actin rods. Interactions with the subcortical maternal complex involve TLE6 isoform 1 and NLRP5, along with interaction with C9orf72.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P23528 (M1-L166)
-
Molecular Construction
-
N-term
-
6*His
-
Cofilin-1 (M1-L166)
Accession # P23528 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CFL1; Cofilin-1; Prev. CFL; Cofilin, Non-Muscle Isoform; Epididymis Secretory Protein Li 15; HEL-S-15; Cofilin 1 (Non-Muscle); Cofilin; 18 KDa Phosphoprotein; Cofilin 1; P18
-
AA Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)