1. Recombinant Proteins
  2. Others
  3. Cofilin-2 Protein, Human (His)

Cofilin-2 protein controls actin polymerization and depolymerization in a pH-sensitive manner. Cofilin-2 Protein, Human (His) is the recombinant human-derived Cofilin-2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cofilin-2 protein controls actin polymerization and depolymerization in a pH-sensitive manner. Cofilin-2 Protein, Human (His) is the recombinant human-derived Cofilin-2 protein, expressed by E. coli , with N-His labeled tag.

Background

Cofilin-2 protein exerts reversible control over actin polymerization and depolymerization, demonstrating pH-sensitive activity. Its capacity for F-actin depolymerization is regulated through an association with CSPR3. Cofilin-2 exhibits the ability to bind both G- and F-actin in a 1:1 ratio, serving as a crucial component in the formation of intranuclear and cytoplasmic actin rods. Essential for muscle maintenance, it may play a role in the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere. Additionally, Cofilin-2 interacts with CSRP3, with the intriguing possibility that two molecules of CFL2 can engage with one molecule of CSRP3.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y281-1 (A2-L166)

Gene ID
Molecular Construction
N-term
His
Cofilin-2 (A2-L166)
Accession # Q9Y281
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cofilin-2; CFL2
AA Sequence

ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

Molecular Weight

Approximately 20 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cofilin-2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Cofilin-2 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cofilin-2 Protein, Human (His)
Cat. No.:
HY-P74234
Quantity:
MCE Japan Authorized Agent: