Cofilin-2 Protein, Human (His)
Based on 1 Customer Validation
Cofilin-2 protein controls actin polymerization and depolymerization in a pH-sensitive manner. Cofilin-2 Protein, Human (His) is the recombinant human-derived Cofilin-2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cofilin-2 protein controls actin polymerization and depolymerization in a pH-sensitive manner. Cofilin-2 Protein, Human (His) is the recombinant human-derived Cofilin-2 protein, expressed by E. coli , with N-His labeled tag.
Background
Cofilin-2 protein exerts reversible control over actin polymerization and depolymerization, demonstrating pH-sensitive activity. Its capacity for F-actin depolymerization is regulated through an association with CSPR3. Cofilin-2 exhibits the ability to bind both G- and F-actin in a 1:1 ratio, serving as a crucial component in the formation of intranuclear and cytoplasmic actin rods. Essential for muscle maintenance, it may play a role in the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere. Additionally, Cofilin-2 interacts with CSRP3, with the intriguing possibility that two molecules of CFL2 can engage with one molecule of CSRP3.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y281-1 (A2-L166)
-
Molecular Construction
-
N-term
-
His
-
Cofilin-2 (A2-L166)
Accession # Q9Y281 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CFL2; CDNA, FLJ94864, Homo Sapiens Cofilin 2 (Muscle) (CFL2), MRNA; Cofilin 2; Cofilin 2 (Muscle), Isoform CRA_c; NEM7; Cofilin 2 (Muscle), Isoform CRA_a; Nemaline Myopathy Type 7; Cofilin, Muscle Isoform; Cofilin 2 (Muscle); Cofilin Isoform; Cofilin-2
-
AA Sequence
ASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
