HCoV-OC43 Spike/S Protein (Sf9, His, myc)

HCoV-OC43 Spike/S Protein, particularly the S1 subunit, initiates infection by attaching the virion to the cell membrane. It interacts with sialic acid-containing cell receptors, facilitating virus binding and marking the initial step in the infection process, establishing a connection with the host receptor for infection commencement. HCoV-OC43 Spike/S Protein (Sf9, His, myc) is the recombinant Virus-derived HCoV-OC43 Spike/S protein, expressed by Sf9 insect cells , with C-Myc, N-10*His labeled tag. The total length of HCoV-OC43 Spike/S Protein (Sf9, His, myc) is 330 a.a., with molecular weight of ~41.0 kDa.

The HCoV-OC43 Spike (S) Protein, specifically the S1 subunit, plays a crucial role in the initiation of infection by attaching the virion to the cell membrane. S1 accomplishes this by interacting with sialic acid-containing cell receptors, facilitating the binding of the virus to the host cell membrane. This pivotal interaction marks the initial step in the infection process, allowing the virus to establish a connection with the host receptor and commence the infection.

Virus

Sf9 insect cells

C-Myc;N-10*His

P36334 (V15-K344)

/

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Approximately 41.0 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.2 μm filtered solution in 10 mM Tris-HCl, 1 mM EDTA, 3% Trehalose, pH 8.0.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.