HCoV-OC43 Spike/S Protein (sf9, His, myc)

HCoV-OC43 Spike/S Protein, particularly the S1 subunit, initiates infection by attaching the virion to the cell membrane. It interacts with sialic acid-containing cell receptors, facilitating virus binding and marking the initial step in the infection process, establishing a connection with the host receptor for infection commencement. HCoV-OC43 Spike/S Protein (sf9, His, myc) is the recombinant Virus-derived HCoV-OC43 Spike/S protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.

The HCoV-OC43 Spike (S) Protein, specifically the S1 subunit, plays a crucial role in the initiation of infection by attaching the virion to the cell membrane. S1 accomplishes this by interacting with sialic acid-containing cell receptors, facilitating the binding of the virus to the host cell membrane. This pivotal interaction marks the initial step in the infection process, allowing the virus to establish a connection with the host receptor and commence the infection.

Virus

Sf9 insect cells

C-Myc;N-10*His

P36334 (V15-K344)

/

Partial

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Approximately 41.0 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

<1.0 EU/μg, determined by LAL method.