CRABP2 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

Background

CRABP2, a critical cellular mediator, plays a pivotal role in the intracellular transport of retinoic acid, facilitating its transit to the nucleus and regulating its access to nuclear retinoic acid receptors. This transport mechanism is central to the intricate cellular processes governed by retinoic acid. Additionally, CRABP2 engages in essential interactions within the cellular milieu, forming complexes with importin alpha, which contribute to its regulatory functions (By similarity). Furthermore, CRABP2 establishes crucial molecular associations with retinoid X receptor (RXR) and retinoic acid receptor alpha (RARA), highlighting its involvement in the intricate network of nuclear receptor signaling pathways. These interactions collectively underscore CRABP2's pivotal role in orchestrating retinoic acid dynamics and its downstream regulatory effects.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CRABP2 (P2-E138)
      Accession # P22935
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CRABP2; Cellular Retinoic Acid-Binding Protein 2; Cellular Retinoic Acid Binding Protein 2; Cellular Retinoic Acid-Binding Protein II; CRABP-II; RBP6

  • AA Sequence

    PNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00