CRABP2 Protein, Mouse (His)
Based on 1 Customer Validation
CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.
CRABP2, a critical cellular mediator, plays a pivotal role in the intracellular transport of retinoic acid, facilitating its transit to the nucleus and regulating its access to nuclear retinoic acid receptors. This transport mechanism is central to the intricate cellular processes governed by retinoic acid. Additionally, CRABP2 engages in essential interactions within the cellular milieu, forming complexes with importin alpha, which contribute to its regulatory functions (By similarity). Furthermore, CRABP2 establishes crucial molecular associations with retinoid X receptor (RXR) and retinoic acid receptor alpha (RARA), highlighting its involvement in the intricate network of nuclear receptor signaling pathways. These interactions collectively underscore CRABP2's pivotal role in orchestrating retinoic acid dynamics and its downstream regulatory effects.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P22935 (P2-E138)
-
Molecular Construction
-
N-term
-
His
-
CRABP2 (P2-E138)
Accession # P22935 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CRABP2; Cellular Retinoic Acid-Binding Protein 2; Cellular Retinoic Acid Binding Protein 2; Cellular Retinoic Acid-Binding Protein II; CRABP-II; RBP6
-
AA Sequence
PNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
