Creatine kinase M-type/CKM Protein, Mouse (His)

CKM is a creatine kinase M-type protein that centrally catalyzes reversible phosphate transfer between ATP and various phosphogens, especially creatine phosphate. As a creatine kinase isoenzyme, CKM plays a crucial role in energy transduction, particularly in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm. Creatine kinase M-type/CKM Protein, Mouse (His) is the recombinant mouse-derived Creatine kinase M-type/CKM protein, expressed by E. coli , with N-6*His labeled tag. The total length of Creatine kinase M-type/CKM Protein, Mouse (His) is 381 a.a., with molecular weight of 49.0 kDa.

The Creatine Kinase M-type (CKM) protein is pivotal in reversibly catalyzing the transfer of phosphate between ATP and various phosphogens, including creatine phosphate. Operating as a creatine kinase isoenzyme, CKM assumes a central role in energy transduction processes, particularly in tissues characterized by substantial and fluctuating energy demands. These tissues encompass skeletal muscle, heart, brain, and spermatozoa, where CKM facilitates the efficient utilization and storage of energy. In doing so, creatine kinase isoenzymes, exemplified by CKM, contribute significantly to maintaining energy homeostasis and meeting dynamic metabolic requirements within these vital tissues.

Mouse

E. coli

N-6*His

P07310 (M1-K381)

12715  [NCBI]

MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

49.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.