CTHRC1 Protein, Human (HEK293, His)

CTHRC1 Protein, Human (HEK293, His) is a negative regulator of collagen matrix deposition. CTHRC1, a secreted 28-kDa protein, is a glycosylated protein with a signal sequence.

CTHRC1 is a secreted 28-kDa protein that is glycosylated and highly conserved from lower chordates to mammals. A short collagen motif with 12 Gly-X-Y repeats appears to be responsible for trimerization of the protein and this renders the molecule susceptible to cleavage by collagenase. Cthrc1 mRNA expression levels are increased in response to transforming growth factor-beta and bone morphogenetic protein-4. Although CTHRC1 is associated with the extracellular matrix and contains a short collagen-like motif, its transient expression in the vessel wall argues against a function as a structural protein unlike other members of the collagen family. A series of articles suggested that overexpression of CTHRC1 promotes tumor progression through various signaling pathways via angiogenesis, the infiltration of tumor-associated macrophages and epithelial-mesenchymal transition^[1][2].

Human

HEK293

C-6*His

Q96CG8 (S31-K243)

115908  [NCBI]

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

25-32 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Xusheng Ding, et al. CTHRC1 promotes gastric cancer metastasis via HIF-1α/CXCR4 signaling pathway. Biomed Pharmacother. 2020 Mar;123:109742.  [Content Brief]

  [2]. Peter Pyagay, et al. Collagen triple helix repeat containing 1, a novel secreted protein in injured and diseased arteries, inhibits collagen expression and promotes cell migration. Circ Res. 2005 Feb 4;96(2):261-8.  [Content Brief]