1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL17
  6. CXCL17 Protein, Rat

C-X-C motif chemokine ligand 17 is the chemokine family member, and has a causative and protective effect in tumorigenesis. CXCL17 Protein, Rat is the recombinant rat-derived CXCL17 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

C-X-C motif chemokine ligand 17 is the chemokine family member, and has a causative and protective effect in tumorigenesis. CXCL17 Protein, Rat is the recombinant rat-derived CXCL17 protein, expressed by E. coli , with tag free.

Background

C-X-C motif chemokine ligand 17 is a mucosal chemokine that attracts immature dendritic cells and blood monocytes to the lungs. C-X-C motif chemokine ligand 17 promotes tumorigenesis through an angiogenic activity. C-X-C motif chemokine ligand 17 exhibits strong antimicrobial activity against E. coli, S. aureus, Salmonella, P. aeruginosa, and C. albicans[1][2][3][4][5].

Biological Activity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/mL, corresponding to a specific activity of >200 IU/mg

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

D4A875 (S23-L119)

Gene ID
Molecular Construction
N-term
CXCL17 (S23-L119)
Accession # D4A875
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-X-C motif chemokine ligand 17; CXCL17
AA Sequence

SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPRKQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL

Predicted Molecular Mass
11.5 kDa
Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CXCL17 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CXCL17 Protein, Rat

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCL17 Protein, Rat
Cat. No.:
HY-P71897
Quantity:
MCE Japan Authorized Agent: