1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL17
  6. CXCL17 Protein, Rat

CXCL17 Protein, Rat

Cat. No.: HY-P71897
COA Handling Instructions

C-X-C motif chemokine ligand 17 is the chemokine family member, and has a causative and protective effect in tumorigenesis. CXCL17 Protein, Rat is the recombinant rat-derived CXCL17 protein, expressed by E. coli , with tag free. The total length of CXCL17 Protein, Rat is 97 a.a., with molecular weight of ~11.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $85 In-stock
50 μg $240 In-stock
100 μg $400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

C-X-C motif chemokine ligand 17 is the chemokine family member, and has a causative and protective effect in tumorigenesis. CXCL17 Protein, Rat is the recombinant rat-derived CXCL17 protein, expressed by E. coli , with tag free. The total length of CXCL17 Protein, Rat is 97 a.a., with molecular weight of ~11.5 kDa.

Background

C-X-C motif chemokine ligand 17 is a mucosal chemokine that attracts immature dendritic cells and blood monocytes to the lungs. C-X-C motif chemokine ligand 17 promotes tumorigenesis through an angiogenic activity. C-X-C motif chemokine ligand 17 exhibits strong antimicrobial activity against E. coli, S. aureus, Salmonella, P. aeruginosa, and C. albicans[1][2][3][4][5].

Biological Activity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/mL, corresponding to a specific activity of >200 IU/mg

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

D4A875 (S23-L119)

Gene ID
Molecular Construction
N-term
CXCL17 (S23-L119)
Accession # D4A875
C-term
Synonyms
C-X-C motif chemokine ligand 17; CXCL17
AA Sequence

SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPRKQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL

Molecular Weight

Approximately 11.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CXCL17 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCL17 Protein, Rat
Cat. No.:
HY-P71897
Quantity:
MCE Japan Authorized Agent: