CXCL17 Protein, Rat
Based on 1 Customer Validation
C-X-C motif chemokine ligand 17 is the chemokine family member, and has a causative and protective effect in tumorigenesis. CXCL17 Protein, Rat is the recombinant rat-derived CXCL17 protein, expressed by E. coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
C-X-C motif chemokine ligand 17 is the chemokine family member, and has a causative and protective effect in tumorigenesis. CXCL17 Protein, Rat is the recombinant rat-derived CXCL17 protein, expressed by E. coli , with tag free.
C-X-C motif chemokine ligand 17 is a mucosal chemokine that attracts immature dendritic cells and blood monocytes to the lungs. C-X-C motif chemokine ligand 17 promotes tumorigenesis through an angiogenic activity. C-X-C motif chemokine ligand 17 exhibits strong antimicrobial activity against E. coli, S. aureus, Salmonella, P. aeruginosa, and C. albicans[1][2][3][4][5].
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/mL, corresponding to a specific activity of >200 IU/mg
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
D4A875 (S23-L119)
-
Molecular Construction
-
N-term
-
CXCL17 (S23-L119)
Accession # D4A875 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL17; Chemokine (C-X-C Motif) Ligand 17; C-X-C Motif Chemokine Ligand 17; VEGF Coregulated Chemokine 1; VCC1; C-X-C Motif Chemokine 17; DMC; 6-Cys CXCL17; UNQ473; VEGF Co-Regulated Chemokine 1; Dcip1; VCC-1; Dendritic Cell And Monocyte Chemokine-Like Pr
-
AA Sequence
SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPRKQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL
-
Predicted Molecular Mass
11.5 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
