1. Recombinant Proteins
  2. Others
  3. DEFB127 Protein, Human (HEK293, Fc)

The DEFB127 protein exhibits significant antibacterial activity, emphasizing its role in the innate immune system's defense against microbial threats. The ability of this protein to defend against bacterial pathogens emphasizes its importance as an effector molecule in host defense mechanisms. DEFB127 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFB127 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The DEFB127 protein exhibits significant antibacterial activity, emphasizing its role in the innate immune system's defense against microbial threats. The ability of this protein to defend against bacterial pathogens emphasizes its importance as an effector molecule in host defense mechanisms. DEFB127 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFB127 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

DEFB127, possesses antibacterial activity. This suggests that the protein plays a role in the innate immune response, particularly in defending against bacterial pathogens. The antimicrobial properties of DEFB127 likely involve its ability to disrupt bacterial membranes or interfere with essential bacterial processes, contributing to the host's defense mechanism. Further investigation into the specific mechanisms and range of bacterial targets for DEFB127's antibacterial activity would provide a more comprehensive understanding of its role in the immune system's response to bacterial infections, potentially leading to applications in the development of novel antimicrobial strategies.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9H1M4 (L21-C63)

Gene ID

140850  [NCBI]

Molecular Construction
N-term
DEFB127 (L21-C63)
Accession # Q9H1M4
hFc
C-term
Protein Length

Full Length of Mature Peptide

Synonyms
Beta-defensin 127; Beta-defensin 27; DEFB-27; C20orf73
AA Sequence

LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC

분자량

Approximately 36 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

DEFB127 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

DEFB127 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
DEFB127 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77350
수량:
MCE Japan Authorized Agent: