DEFB127 Protein, Human (HEK293, Fc)

The DEFB127 protein exhibits significant antibacterial activity, emphasizing its role in the innate immune system's defense against microbial threats. The ability of this protein to defend against bacterial pathogens emphasizes its importance as an effector molecule in host defense mechanisms. DEFB127 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFB127 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of DEFB127 Protein, Human (HEK293, Fc) is 63 a.a., with molecular weight of ~36 KDa.

DEFB127, possesses antibacterial activity. This suggests that the protein plays a role in the innate immune response, particularly in defending against bacterial pathogens. The antimicrobial properties of DEFB127 likely involve its ability to disrupt bacterial membranes or interfere with essential bacterial processes, contributing to the host's defense mechanism. Further investigation into the specific mechanisms and range of bacterial targets for DEFB127's antibacterial activity would provide a more comprehensive understanding of its role in the immune system's response to bacterial infections, potentially leading to applications in the development of novel antimicrobial strategies.

Human

HEK293

C-hFc

Q9H1M4 (L21-C63)

140850  [NCBI]

LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC

Approximately 36 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.