1. Recombinant Proteins
  2. Others
  3. DEFB127 Protein, Human (HEK293, Fc)

DEFB127 Protein, Human (HEK293, Fc)

Cat. No.: HY-P77350
SDS COA Handling Instructions

The DEFB127 protein exhibits significant antibacterial activity, emphasizing its role in the innate immune system's defense against microbial threats. The ability of this protein to defend against bacterial pathogens emphasizes its importance as an effector molecule in host defense mechanisms. DEFB127 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFB127 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DEFB127 protein exhibits significant antibacterial activity, emphasizing its role in the innate immune system's defense against microbial threats. The ability of this protein to defend against bacterial pathogens emphasizes its importance as an effector molecule in host defense mechanisms. DEFB127 Protein, Human (HEK293, Fc) is the recombinant human-derived DEFB127 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

DEFB127, possesses antibacterial activity. This suggests that the protein plays a role in the innate immune response, particularly in defending against bacterial pathogens. The antimicrobial properties of DEFB127 likely involve its ability to disrupt bacterial membranes or interfere with essential bacterial processes, contributing to the host's defense mechanism. Further investigation into the specific mechanisms and range of bacterial targets for DEFB127's antibacterial activity would provide a more comprehensive understanding of its role in the immune system's response to bacterial infections, potentially leading to applications in the development of novel antimicrobial strategies.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9H1M4 (L21-C63)

Gene ID

140850  [NCBI]

Molecular Construction
N-term
DEFB127 (L21-C63)
Accession # Q9H1M4
hFc
C-term
Synonyms
Beta-defensin 127; Beta-defensin 27; DEFB-27; C20orf73
AA Sequence

LKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC

Molecular Weight

Approximately 36 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DEFB127 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DEFB127 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77350
Quantity:
MCE Japan Authorized Agent: