Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His)
Based on 1 Customer Validation
The Der p 23 protein was identified as a member of the allergic house dust mite proteins and does not exhibit chitin-binding ability in vitro. This unique feature distinguishes Der p 23 from other proteins known for their affinity to chitin, emphasizing its unique properties. Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) is the recombinant Der p 23 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Others
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The Der p 23 protein was identified as a member of the allergic house dust mite proteins and does not exhibit chitin-binding ability in vitro. This unique feature distinguishes Der p 23 from other proteins known for their affinity to chitin, emphasizing its unique properties. Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) is the recombinant Der p 23 protein, expressed by HEK293 , with C-His labeled tag.
Background
Der p 23 protein, as indicated by available information, does not exhibit chitin-binding activity in vitro. Chitin is a polysaccharide often associated with the exoskeletons of insects and the cell walls of fungi, and the absence of chitin binding in Der p 23 suggests a unique functional profile. Additionally, Der p 23 is described as a monomeric protein, implying that it exists as a single, independent unit rather than forming complexes with other molecules. Understanding these characteristics is crucial for unraveling the biological role of Der p 23, particularly in the context of its interactions with environmental factors, and further research is needed to delineate the specific functions and implications of this protein within relevant physiological contexts. (
Technical Parameters
-
Species Others
-
Source HEK293
-
Tag C-His
-
Accession
L7N6F8 (A22-T90)
-
Gene ID113788516 [NCBI]
-
Molecular Construction
-
N-term
-
DEP23 (A22-T90)
Accession # L7N6F8 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Major mite allergen Der p 23; Major house dust mite allergen Der p 23; Major HDM allergen Der p 23; Peritrophin-like protein Der p 23; Der p 23
-
AA Sequence
ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)