DKK-1 Protein, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

DKK1 protein functions as a potent antagonist of canonical Wnt signaling through multiple mechanisms. It inhibits the interaction between LRP5/6 and Wnt and forms a ternary complex with the transmembrane protein KREMEN, facilitating the internalization of LRP5/6. Notably, DKK1 not only antagonizes the pro-apoptotic function of KREMEN1 in a Wnt-independent manner but also exhibits anti-apoptotic activity. The protein is implicated in limb development, where it modulates Wnt signaling to ensure normal limb patterning. Through its C-terminal Cys-rich domain, DKK1 interacts with LRP5 and LRP6, specifically engaging with beta-propeller regions 3 and 4 of LRP5. This interaction is further influenced by MESD and/or KREMEN, collectively leading to the attenuation of Wnt-mediated signaling. Additionally, DKK1 forms a ternary complex with LRP6 and KREM1, highlighting its multifaceted role in regulating crucial cellular processes and interactions with key proteins involved in Wnt signaling.

Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED₅₀ this effect is <0.4 μg/mL in the presence of 10 ng/mL of Human Wnt3a.

• 
  Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED₅₀ for this effect is 61.12 ng/mL in the presence of 10 ng/mL of Human Wnt3a, corresponding to a specific activity is 1.636×10⁴ units/mg.

Human

HEK293

Tag Free

O94907 (T32-H266)

22943  [NCBI]

Full Length of Mature Protein

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Approximately 38-48 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.