1. Recombinant Proteins
  2. Others
  3. DKK-1 Protein, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Background

DKK1 protein functions as a potent antagonist of canonical Wnt signaling through multiple mechanisms. It inhibits the interaction between LRP5/6 and Wnt and forms a ternary complex with the transmembrane protein KREMEN, facilitating the internalization of LRP5/6. Notably, DKK1 not only antagonizes the pro-apoptotic function of KREMEN1 in a Wnt-independent manner but also exhibits anti-apoptotic activity. The protein is implicated in limb development, where it modulates Wnt signaling to ensure normal limb patterning. Through its C-terminal Cys-rich domain, DKK1 interacts with LRP5 and LRP6, specifically engaging with beta-propeller regions 3 and 4 of LRP5. This interaction is further influenced by MESD and/or KREMEN, collectively leading to the attenuation of Wnt-mediated signaling. Additionally, DKK1 forms a ternary complex with LRP6 and KREM1, highlighting its multifaceted role in regulating crucial cellular processes and interactions with key proteins involved in Wnt signaling.

Biological Activity

Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 this effect is ≤163.4 ng/mL in the presence of 10 ng/mL of Human Wnt3a, corresponding to a specific activity is ≥6.12×103 units/mg.

  • Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is 61.12 ng/mL in the presence of 10 ng/mL of Human Wnt3a, corresponding to a specific activity is 1.636×104 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

O94907 (T32-H266)

Gene ID
Molecular Construction
N-term
DKK-1 (T32-H266)
Accession # O94907
C-term
Synonyms
rHuDKK-1; hDkk-1; SK
AA Sequence

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DKK-1 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DKK-1 Protein, Human (HEK293)
Cat. No.:
HY-P7155B
Quantity:
MCE Japan Authorized Agent: