Copy Link Print Information

DKK-1 Protein, Human (HEK293, His)

11 Cited Publications
Customer Review

Based on 11 publication(s) in Google Scholar

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • DKK-1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Background

Human Dickkopf Related Protein-1 a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the Wnt signaling pathway. Dickkopf WNT signaling pathway inhibitor 1 (Dkk1) is a protein-coding gene that acts from the anterior visceral endoderm[1][2]. DKK1 is demonstrated to antagonize the Wnt/β-catenin pathway via a reduction in β-catenin and an increase in OCT4 expression[3].

Verified Bioactivity

1. The ED50 is <4 μg/mL as measured in stimulation of alkaline phosphatase activity using CCl-226 cells.
2. Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1-0.8 μg/mL  in the presence of 10 ng/mL of mouse Wnt3a.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    O94907 (T32-R265)

  • Gene ID
    22943  [NCBI]
  • Molecular Construction
    • N-term
    • DKK-1 (T32-H266)
      Accession # O94907
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    DKK1; Dickkopf 1 Homolog (Xenopus Laevis); Dickkopf Wnt Signaling Pathway Inhibitor 1; Dickkopf 1 Homolog; SK; Dickkopf-1 Like; DKK-1; Dickkopf-1; Dickkopf-Related Protein 1; HDkk-1; Dickkopf-Like Protein 1; Dkk-1; Dickkopf (Xenopus Laevis) Homolog 1

  • AA Sequence

    TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR

  • Molecular Weight

    Approximately 38-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.

[2]. Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3): 423–34. [Content Brief]

[3]. Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1): 720–30. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.3146 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 3.179×103 units/mg.

  • 1/16

    DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2022 Oct;26(4):306. [Abstract]

    Customer Validation
     Effect of DKK-1 protein (780 nM) on the expression of Wnt signaling pathway proteins. Representative Western blot images of LRP6.

  • 1/16

    DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2022 Oct;26(4):306. [Abstract]

    Customer Validation
     Effect of DKK-1 protein (780 nM) on the expression of Wnt signaling pathway proteins. Representative Western blot images of β-catenin, Wnt5a/b, c-Myc, and ANP.

  • 1/16

    DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Front Microbiol. 2020 May 27:11:1097. [Abstract]

    Customer Validation
     Following Dkk-1 treatment, the expression of 7-Frz and β-catenin was upregulated in Caco-2 cells. The cells were randomly assigned to a control group and experimental groups (10, 100, and 200 ng groups). The Dkk-1 dosages for the experimental groups were 10, 100, and 200 ng, respectively.

  • DKK-1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Human (HEK293, His)
  • DKK-1 Protein, Human (HEK293, His) Product Image

  • DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2022 Oct;26(4):306. [Abstract]

    Effect of DKK-1 protein (780 nM) on the expression of Wnt signaling pathway proteins. Representative Western blot images of LRP6.

  • DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2022 Oct;26(4):306. [Abstract]

    Effect of DKK-1 protein (780 nM) on the expression of Wnt signaling pathway proteins. Representative Western blot images of β-catenin, Wnt5a/b, c-Myc, and ANP.

  • DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Front Microbiol. 2020 May 27:11:1097. [Abstract]

    Following Dkk-1 treatment, the expression of 7-Frz and β-catenin was upregulated in Caco-2 cells. The cells were randomly assigned to a control group and experimental groups (10, 100, and 200 ng groups). The Dkk-1 dosages for the experimental groups were 10, 100, and 200 ng, respectively.