DKK-1 Protein, Human (HEK293, His)

Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.

Human Dickkopf Related Protein-1 a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the Wnt signaling pathway. Dickkopf WNT signaling pathway inhibitor 1 (Dkk1) is a protein-coding gene that acts from the anterior visceral endoderm^[1][2]. DKK1 is demonstrated to antagonize the Wnt/β-catenin pathway via a reduction in β-catenin and an increase in OCT4 expression^[3].

The ED₅₀ is <4 μg/mL as measured in stimulation of alkaline phosphatase activity using CCl-226 cells.

Human

HEK293

C-His

O94907 (T32-H266)

22943  [NCBI]

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHHHHHHH

38-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Schneider VA, et al. Spatially distinct head and heart inducers within the Xenopus organizer region. Curr Biol. 9: 800–809.

  [2]. Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3): 423–34.  [Content Brief]

  [3]. Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1): 720–30.  [Content Brief]