DKK-1 Protein, Human (HEK293, His)
Based on 11 publication(s) in Google Scholar
Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Dkk-1 Protein, Human (HEK293) is involved in embryonic development through its inhibition of the Wnt signaling pathway.
Background
Human Dickkopf Related Protein-1 a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the Wnt signaling pathway. Dickkopf WNT signaling pathway inhibitor 1 (Dkk1) is a protein-coding gene that acts from the anterior visceral endoderm[1][2]. DKK1 is demonstrated to antagonize the Wnt/β-catenin pathway via a reduction in β-catenin and an increase in OCT4 expression[3].
Verified Bioactivity
1. The ED50 is <4 μg/mL as measured in stimulation of alkaline phosphatase activity using CCl-226 cells.
2. Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1-0.8 μg/mL in the presence of 10 ng/mL of mouse Wnt3a.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (11)
-
Journal Impact Factor
-
Most Recent
-
Cancer Lett
ACLP promotes activation of cancer-associated fibroblasts and tumor metastasis via ACLP-PPARγ-ACLP feedback loop in pancreatic cancer. [Abstract]2022 Sep 28:544:215802. PMID: 35732215 -
Acta Biomater
Modulation of the mechanosensing of mesenchymal stem cells by laser-induced patterning for the acceleration of tissue reconstruction through the Wnt/β-catenin signaling pathway activation. [Abstract]2020 Jan 1:101:152-167. PMID: 31678738 -
J Agric Food Chem
Influence of Calcium Supplementation against Fluoride-Mediated Osteoblast Impairment in Vitro: Involvement of the Canonical Wnt/β-Catenin Signaling Pathway. [Abstract]2019 Sep 18;67(37):10285-10295. PMID: 31443611 -
Front Microbiol
Core Fucosylation of Intestinal Epithelial Cells Protects Against Salmonella Typhi Infection via Up-Regulating the Biological Antagonism of Intestinal Microbiota. [Abstract]2020 May 27:11:1097. PMID: 32528455
DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Front Microbiol. 2020 May 27:11:1097. [Abstract]
Following Dkk-1 treatment, the expression of 7-Frz and β-catenin was upregulated in Caco-2 cells. The cells were randomly assigned to a control group and experimental groups (10, 100, and 200 ng groups). The Dkk-1 dosages for the experimental groups were 10, 100, and 200 ng, respectively.
-
Int Immunopharmacol
Preliminary investigation on the mechanism of baicalein regulating the effects of Nischarin on invasion and apoptosis of human breast cancer cells MCF-7 through Wnt3α/β-catenin pathway. [Abstract]2024 Sep 30;143(Pt 1):113262. PMID: 39353394 -
Mol Med Rep
Puerarin attenuates isoproterenol‑induced myocardial hypertrophy via inhibition of the Wnt/β‑catenin signaling pathway. [Abstract]2022 Oct;26(4):306. PMID: 35946454
DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2022 Oct;26(4):306. [Abstract]
Effect of DKK-1 protein (780 nM) on the expression of Wnt signaling pathway proteins. Representative Western blot images of LRP6.
DKK-1 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Med Rep. 2022 Oct;26(4):306. [Abstract]
Effect of DKK-1 protein (780 nM) on the expression of Wnt signaling pathway proteins. Representative Western blot images of β-catenin, Wnt5a/b, c-Myc, and ANP.
-
Exp Ther Med
LRRC17 regulates the bone metabolism of human bone marrow mesenchymal stem cells from patients with idiopathic necrosis of femoral head through Wnt signaling pathways: A preliminary report. [Abstract]2021 Jul;22(1):666. PMID: 33986831 -
J Stroke Cerebrovasc Dis
Hirudin promotes cerebral angiogenesis and exerts neuroprotective effects in MCAO/R rats by activating the Wnt/β-catenin pathway. [Abstract]2025 Mar;34(3):108218. PMID: 39753184 -
-
-
Biomed Pharmacother
Down-regulation of LECT2 promotes osteogenic differentiation of MSCs via activating Wnt/β-catenin pathway. [Abstract]2020 Oct:130:110593. PMID: 32763823
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
O94907 (T32-R265)
-
Molecular Construction
-
N-term
-
DKK-1 (T32-H266)
Accession # O94907 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
DKK1; Dickkopf 1 Homolog (Xenopus Laevis); Dickkopf Wnt Signaling Pathway Inhibitor 1; Dickkopf 1 Homolog; SK; Dickkopf-1 Like; DKK-1; Dickkopf-1; Dickkopf-Related Protein 1; HDkk-1; Dickkopf-Like Protein 1; Dkk-1; Dickkopf (Xenopus Laevis) Homolog 1
-
AA Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQR
-
Molecular Weight
Approximately 38-50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[2]. Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Developmental Cell. 1 (3): 423–34. [Content Brief]
[3]. Ou L, et al. Dickkopf Wnt signaling pathway inhibitor 1 regulates the differentiation of mouse embryonic stem cells in vitro and in vivo. Molecular Medicine Reports. 13 (1): 720–30. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)