Envelope small membrane Protein, HCoV-NL63 (Cell-Free, His)

Enveloped small membrane proteins play a central role in viral morphogenesis and assembly, acting as viroporins that self-assemble in the host membrane to form homopentameric protein-lipid pores that facilitate ion transport. In addition to virus formation, it induces apoptosis and interacts with membrane protein M in the budding compartment of the host cell while binding to nuclear proteins. Envelope small membrane Protein, HCoV-NL63 (Cell-Free, His) is the recombinant Virus-derived Envelope small membrane protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of Envelope small membrane Protein, HCoV-NL63 (Cell-Free, His) is 77 a.a., with molecular weight of 12.0 kDa.

The Envelope Small Membrane Protein assumes a central role in virus morphogenesis and assembly, functioning as a viroporin that self-assembles in host membranes, forming homopentameric protein-lipid pores facilitating ion transport. Beyond its involvement in virus formation, it also plays a significant role in the induction of apoptosis. Existing as a homopentamer, this protein interacts with the membrane protein M in the host cell's budding compartment, situated between the endoplasmic reticulum and the Golgi complex. Additionally, it engages with the Nucleoprotein, contributing to the intricate interplay of proteins crucial for the virus life cycle within the host cellular environment. The multifaceted functions of the Envelope Small Membrane Protein highlight its pivotal role in the dynamic processes of virus assembly, membrane interaction, and apoptotic induction.

Virus

E. coli Cell-free

N-10*His

Q6Q1S0 (M1-V77)

2943502

MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV

12.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.