EpCAM/TROP1 Protein, Mouse (HEK293, Fc)

The EpCAM/TROP1 protein participates in multiple processes, serving as homologous interacting molecules that facilitate communication between mucosal epithelial midgut epithelial cells (IECs) and intraepithelial lymphocytes (IELs). This helps form an immune barrier against mucosal infections. EpCAM/TROP1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of EpCAM/TROP1 Protein, Mouse (HEK293, Fc) is 243 a.a., with molecular weight of 60-80 kDa.

EpCAM/TROP1 protein is involved in various biological processes. It may function as a physical homophilic interaction molecule, facilitating communication between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium, thereby contributing to the immunological barrier as a primary defense against mucosal infections. Additionally, EpCAM/TROP1 plays a role in the proliferation and differentiation of embryonic stem cells. It is also known to up-regulate the expression of FABP5, MYC, and cyclins A and E, potentially influencing cell cycle progression. EpCAM/TROP1 exists as a monomer and interacts with phosphorylated CLDN7.

Mouse

HEK293

C-hFc

Q99JW5 (Q24-T266)

17075  [NCBI]

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

60-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.