1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. Epithelial Cell Adhesion Molecule (EpCAM) Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD326/EpCAM
  5. EpCAM/TROP1 Protein, Mouse (HEK293, Fc)

The EpCAM/TROP1 protein participates in multiple processes, serving as homologous interacting molecules that facilitate communication between mucosal epithelial midgut epithelial cells (IECs) and intraepithelial lymphocytes (IELs).This helps form an immune barrier against mucosal infections.EpCAM/TROP1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The EpCAM/TROP1 protein participates in multiple processes, serving as homologous interacting molecules that facilitate communication between mucosal epithelial midgut epithelial cells (IECs) and intraepithelial lymphocytes (IELs).This helps form an immune barrier against mucosal infections.EpCAM/TROP1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

EpCAM/TROP1 protein is involved in various biological processes. It may function as a physical homophilic interaction molecule, facilitating communication between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium, thereby contributing to the immunological barrier as a primary defense against mucosal infections. Additionally, EpCAM/TROP1 plays a role in the proliferation and differentiation of embryonic stem cells. It is also known to up-regulate the expression of FABP5, MYC, and cyclins A and E, potentially influencing cell cycle progression. EpCAM/TROP1 exists as a monomer and interacts with phosphorylated CLDN7.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED50 for this effect is 1.568 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 637.755 units/mg.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q99JW5 (Q24-T266)

Gene ID
Molecular Construction
N-term
EpCAM (Q24-T266)
Accession # Q99JW5
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
17-1A; 323/A3; ACSTD1; CD326; EGP-2; EGP314; EGP40; EpCAM; MOC31; TACST-1; TACSTD1; TROP1;
AA Sequence

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

분자량

60-80 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

EpCAM/TROP1 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
EpCAM/TROP1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70900
수량:
MCE Japan Authorized Agent: