Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Coagulation Factor XII, also known as F12, is a serum glycoprotein with multifaceted roles in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Factor XII participates in the intricate cascade of events by cleaving prekallikrein to form kallikrein. Subsequently, factor XII undergoes cleavage itself, initially to alpha-factor XIIa and then to beta-factor XIIa through trypsin activity. Notably, alpha-factor XIIa is implicated in the activation of Factor XI to Factor XIa, contributing to the propagation of the coagulation cascade.

Pig

P. pastoris

N-6*His

O97507 (I20-R371)

397474  [NCBI]

Full Length of F12 heavy chain

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.