Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His)
Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Pig
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.
Background
Coagulation Factor XII, also known as F12, is a serum glycoprotein with multifaceted roles in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Factor XII participates in the intricate cascade of events by cleaving prekallikrein to form kallikrein. Subsequently, factor XII undergoes cleavage itself, initially to alpha-factor XIIa and then to beta-factor XIIa through trypsin activity. Notably, alpha-factor XIIa is implicated in the activation of Factor XI to Factor XIa, contributing to the propagation of the coagulation cascade.
Technical Parameters
-
Species Pig
-
Source P. pastoris
-
Tag N-6*His
-
Accession
O97507 (I20-R371)
-
Molecular Construction
-
N-term
-
6*His
-
F12 (I20-R371)
Accession # O97507 -
C-term
-
-
Protein Length
Full Length of F12 heavy chain
-
Synonyms
F12; Coagulation Factor XIIa Heavy Chain; Coagulation Factor XII; Coagulation Factor XIIa Light Chain; Hageman Factor; Beta-Factor XIIa Part 1; Plasma Coagulation Factor XIIa; Beta-Factor XIIa Part 2; HAF; HAE3; Coagulation Factor XII (Hageman Factor); HA
-
AA Sequence
IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR
-
Predicted Molecular Mass
41.8 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
