FCRL1 Protein, Human (287a.a, HEK293, His)

The FCRL1 protein may act as an activation coreceptor in B cells, suggesting involvement in B cell activation and differentiation processes. The dual role of FCRL1 makes it a key player in regulating B cell responses and enhancing signaling pathways associated with B cell activation. FCRL1 Protein, Human (287a.a, HEK293, His) is the recombinant human-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag. The total length of FCRL1 Protein, Human (287a.a, HEK293, His) is 287 a.a., with molecular weight of 39-50 kDa.

The FCRL1 Protein takes on a potential role as an activating coreceptor in B-cells, suggesting its involvement in the intricate processes of B-cell activation and differentiation. This dual functionality positions FCRL1 as a key player in the modulation of B-cell responses, where it may act as a coreceptor to enhance signaling pathways associated with B-cell activation. The broader implication of FCRL1 in B-cell differentiation underscores its significance in orchestrating the nuanced cellular events that contribute to the adaptive immune response.

Human

HEK293

C-His

Q96LA6 (A17-N303)

115350  [NCBI]

AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSN

39-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 1 mM EDTA.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.