FCRL1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The FCRL1 protein may act as an activation coreceptor in B cells, suggesting involvement in B cell activation and differentiation processes. The dual role of FCRL1 makes it a key player in regulating B cell responses and enhancing signaling pathways associated with B cell activation. FCRL1 Protein, Human (HEK293, His) is the recombinant human-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FCRL1 protein may act as an activation coreceptor in B cells, suggesting involvement in B cell activation and differentiation processes. The dual role of FCRL1 makes it a key player in regulating B cell responses and enhancing signaling pathways associated with B cell activation. FCRL1 Protein, Human (HEK293, His) is the recombinant human-derived FCRL1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The FCRL1 Protein takes on a potential role as an activating coreceptor in B-cells, suggesting its involvement in the intricate processes of B-cell activation and differentiation. This dual functionality positions FCRL1 as a key player in the modulation of B-cell responses, where it may act as a coreceptor to enhance signaling pathways associated with B-cell activation. The broader implication of FCRL1 in B-cell differentiation underscores its significance in orchestrating the nuanced cellular events that contribute to the adaptive immune response.
Verified Bioactivity
Immobilized FCRL1 at 2 μg/mL (100 μL/well) can bind biotinylated Human IgG. The KD for this effect is 38.39 nM.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q96LA6-1 (A17-N303)
-
Molecular Construction
-
N-term
-
FCRL1 (A17-N303)
Accession # Q96LA6-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FCRL1; Fc Receptor Homolog 1; Fc Receptor Like 1; FcR-Like Protein 1; FCRH1; HIFGP1; IRTA5; Immunoglobulin Superfamily Fc Receptor, Gp42; IFGP1; Fc Receptor-Like 1; CD307a; CD307a Antigen; Immune Receptor Translocation-Associated Protein 5; FcRH1; Fc Rece
-
AA Sequence
AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSN
-
Predicted Molecular Mass
32.6 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 1 mM EDTA.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
