HO-1 Protein, Mouse (His)

HO-1 Protein catalyzes the oxidative cleavage of heme, releasing carbon monoxide (CO) and ferrous iron. It provides protection against programmed cell death by catabolizing free heme, preventing apoptosis sensitization. HO-1 Protein, Mouse (His) is the recombinant mouse-derived HO-1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of HO-1 Protein, Mouse (His) is 289 a.a., with molecular weight of ~35 kDa.

HO-1 protein, through its catalytic activity, orchestrates the oxidative cleavage of heme at the alpha-methene bridge carbon, leading to the release of carbon monoxide (CO) and the generation of biliverdin IXalpha. Simultaneously, it liberates the central heme iron chelate as ferrous iron. This enzymatic process not only provides a mechanism for the breakdown of heme but also exerts a cytoprotective effect by preventing the sensitization of cells to programmed cell death or apoptosis. The ability of HO-1 to catabolize free heme underscores its crucial role in cellular defense mechanisms, contributing to cell survival and protection against various stressors.

Mouse

P. pastoris

N-6*His

P14901 (M1-M289)

15368  [NCBI]

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Approximately 35 KDa

Greater than 90 % as determined by SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of Tris-based buffer,50% glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.