FKBP14 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.
FKBP14 Protein emerges as a peptidyl-prolyl cis-trans isomerase (PPIase) with a distinctive role in expediting the folding of proteins, particularly during the intricate process of protein synthesis. Notably, FKBP14 exhibits a specific preference for substrates featuring 4-hydroxylproline modifications, with a pronounced affinity for type III collagen. Beyond its primary substrate, FKBP14 may also extend its catalytic activity to target type VI and type X collagens, suggesting a broader influence on the folding dynamics of diverse collagen types. The protein's ability to accelerate the folding of collagen molecules underscores its significance in modulating the structural integrity of these key extracellular matrix components, emphasizing FKBP14's potential impact on cellular and tissue physiology. Further exploration is warranted to elucidate the specific molecular mechanisms through which FKBP14 selectively acts on collagen substrates and to uncover its broader functional implications in protein folding processes.
Measured by its ability to convert the substrate, Suc-AAPF-pNA, from Cis to Trans formation. The specific activity is 420.07 pmol/min/μg, as measured under the described conditions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q9NWM8 (A20-K207)
-
Molecular Construction
-
N-term
-
FKBP14 (A20-K207)
Accession # Q9NWM8 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FKBP14; Rotamase; FKBP Prolyl Isomerase 14; FKBP-22; FKBP22; FK506 Binding Protein 14 (22 KDa); Peptidyl-Prolyl Cis-Trans Isomerase FKBP14; FK506 Binding Protein 14; FK506 Binding Protein 14, 22 KDa; Peptidylprolyl Isomerase; 22 KDa FK506-Binding Protein;
-
AA Sequence
ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYK
-
Molecular Weight
Approximately 25 kDa & 27 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
