Copy Link Print Information

FLT3LG Protein, Human (CHO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human (CHO) is the recombinant human-derived FLT3LG protein, expressed by CHO cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FLT3LG Protein, Human (CHO)
  • Experimental Validation Results for FLT3LG Protein, Human (CHO)
  • FLT3LG Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human (CHO) is the recombinant human-derived FLT3LG protein, expressed by CHO cells , with tag free.

Background

FLT3LG protein serves as a potent stimulator of early hematopoietic cell proliferation through the activation of FLT3, demonstrating synergistic effects when combined with various colony-stimulating factors and interleukins. This homodimeric protein, particularly in isoform 2, plays a crucial role in promoting the expansion and differentiation of hematopoietic progenitor cells. Its ability to activate FLT3 and collaborate with other signaling molecules underscores its significance in regulating hematopoiesis and maintaining the balance of the hematopoietic system.

Verified Bioactivity

1.The ED50 is <1 ng/mL as measured by human AML5 cells, corresponding to a specific activity of >1 × 106 units/mg.
2.Measured in a cell proliferation assay using HL-60 cells. The ED50 for this effect is 0.9476 ng/mL, corresponding to a specific activity is 1.055×106 units/mg.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P49771-1 (T27-P185)

  • Gene ID
    2323  [NCBI]
  • Molecular Construction
    • N-term
    • FLT3LG (T27-P185)
      Accession # P49771-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FLT3LG; IMD125; Fms Related Receptor Tyrosine Kinase 3 Ligand; FLG3L; Fms-Related Tyrosine Kinase 3 Ligand; FLT3L; Fms Related Tyrosine Kinase 3 Ligand; Flt3L; Flt3 Ligand; FL; SL Cytokine

  • AA Sequence

    TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

  • Molecular Weight

    Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Li F, et al. Fms-related tyrosine kinase 3 ligand promotes proliferation of placenta amnion and chorion mesenchymal stem cells in vitro. Mol Med Rep. 2014 Jul;10(1):322-8. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HL-60 cells. The ED50 for this effect is 0.9476 ng/mL, corresponding to a specific activity is 1.055×106 units/mg.

  • FLT3LG Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for FLT3LG Protein, Human (CHO)
  • Experimental Validation Results for FLT3LG Protein, Human (CHO)
  • FLT3LG Protein, Human (CHO) Product Image