FLT3LG Protein, Human (CHO)

FLT3LG Protein, Human (CHO) is a cytokine, which can promote the generation and differentiation of hematopoietic stem cells and their progenitor cells.

Fms-related tyrosine kinase 3 ligand is a type of cell factor, able to promote the generation and differentiation of hematopoietic stem cells and their progenitor cells. The mRNA of Fms-related tyrosine kinase 3 ligand is highly expressed in certain tissues, including peripheral blood mononuclear cells, the heart, placenta, lung, spleen and thymus tissue, and is also expressed to a certain extent in non-hematopoietic tissues, including the prostate, testis, ovaries, intestines, liver, kidney and skeletal muscle^[1].

The ED₅₀ is <1 ng/mL as measured by human AML5 cells, corresponding to a specific activity of >1 × 10⁶ units/mg.

Human

CHO

Tag Free

P49771 (T27-P185)

2323  [NCBI]

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

18-22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Li F, et al. Fms-related tyrosine kinase 3 ligand promotes proliferation of placenta amnion and chorion mesenchymal stem cells in vitro. Mol Med Rep. 2014 Jul;10(1):322-8.  [Content Brief]