Frizzled-9 Protein, Mouse (HEK293, mFc)
Based on 1 Customer Validation
Frizzled-9 is a WNT2 receptor that is critical for activation of the β-catenin pathway, involved in Disheveled protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. In addition to classical signaling, it negatively regulates acetylcholine receptor clustering in neuromuscular junction assembly and affects the viability of neural progenitor cells by regulating the cell cycle. Frizzled-9 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived Frizzled-9 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Frizzled-9 is a WNT2 receptor that is critical for activation of the β-catenin pathway, involved in Disheveled protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. In addition to classical signaling, it negatively regulates acetylcholine receptor clustering in neuromuscular junction assembly and affects the viability of neural progenitor cells by regulating the cell cycle. Frizzled-9 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived Frizzled-9 protein, expressed by HEK293 , with C-mFc labeled tag.
Frizzled-9, serving as the receptor for WNT2, is a crucial player in the beta-catenin canonical signaling pathway, orchestrating the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Beyond its role in canonical Wnt signaling, Frizzled-9 exhibits multifaceted functions. It contributes to neuromuscular junction (NMJ) assembly by negatively regulating the clustering of acetylcholine receptors (AChR) through the beta-catenin pathway. In neural progenitor cells (NPCs), Frizzled-9 influences cell viability by negatively regulating cell cycle arrest, thereby inhibiting the apoptotic process. The receptor's involvement in hippocampal development includes the regulation of neuroblast proliferation and apoptotic cell death. Moreover, Frizzled-9 plays a pivotal role in bone dynamics, modulating bone formation through non-canonical Wnt signaling mediated via ISG15 and positively impacting bone regeneration through non-canonical Wnt signaling pathways.
Measured by its ability to bind biotinylated mouse Wnt-3a in a funtional ELISA with an estimated Kd 2.263 nM.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-mFc
-
Accession
Q9R216 (L24-D186)
-
Molecular Construction
-
N-term
-
Frizzled-9 (L24-D186)
Accession # Q9R216 -
mFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FZD9; Frizzled Family Receptor 9; Frizzled Class Receptor 9; HFz9; FZD3; FzE6; Frizzled-9; Fz-9; CD349; Frizzled (Drosophila) Homolog 9; Frizzled 9, Seven Transmembrane Spanning Receptor; Frizzled Homolog 9; Frizzled Homolog 9 (Drosophila); CD349 Antigen
-
AA Sequence
LEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGD
-
Molecular Weight
Approximately 58-66 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
