GJA1 Protein, Bovine (Cell-Free, His)

Gap junction protein GJA1 regulates bladder capacity and facilitates intercellular communication. It also plays a potential role in hearing and influences cell growth inhibition. GJA1 interacts with partners like SGSM3, RIC1/CIP150, CNST, and NOV, contributing to its diverse functions. GJA1 Protein, Bovine (Cell-Free, His) is the recombinant bovine-derived GJA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of GJA1 Protein, Bovine (Cell-Free, His) is 382 a.a., with molecular weight of 44.6 kDa.

Gap junction protein GJA1 serves as a crucial regulator of bladder capacity. Forming a gap junction, GJA1 facilitates the exchange of low molecular weight materials between adjacent cells through connexons, contributing to the regulation of bladder function. In addition to its role in bladder physiology, GJA1 plays a potential key function in hearing by participating in the recycling of potassium to the cochlear endolymph. Acting as a negative regulator of bladder functional capacity, GJA1 enhances intercellular electrical and chemical transmission, heightening sensitivity to cholinergic neural stimuli and inducing contraction in bladder muscles. Moreover, GJA1 may influence cell growth inhibition by regulating the expression and localization of NOV. It is indispensable for gap junction communication in the ventricles and forms connexons composed of hexamers of connexins. The protein interacts with various partners, including SGSM3, RIC1/CIP150, CNST, CSNK1D, TJP1, SRC, UBQLN4, NOV, and TMEM65, contributing to its diverse cellular functions.

Bovine

E. coli Cell-free

N-10*His

P18246 (G2-I383)

281193

GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVVAQTDGANVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHTTTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDHQNSKKLDAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

44.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.