glycoprotein D/gD Protein, HHV-2 (Cell-Free, His)

Glycoprotein D/gD proteins bind to host cell receptors TNFRSF14/HVEM and NECTIN1, triggering fusion with the host membrane by recruiting gB and gH/gL. glycoprotein D/gD Protein, HHV-2 (Cell-Free, His) is the recombinant Virus-derived glycoprotein D/gD protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of glycoprotein D/gD Protein, HHV-2 (Cell-Free, His) is 368 a.a., with molecular weight of 42.3 kDa.

Envelope glycoprotein D (gD) plays a pivotal role in the viral life cycle by binding to potential host cell entry receptors, including TNFRSF14/HVEM and NECTIN1. Its interaction with these receptors may initiate fusion with the host membrane, a crucial step facilitated by the recruitment of the fusion machinery composed of gB and gH/gL. Existing as a homodimer, gD engages in various interactions with host receptors, such as TNFRSF14 and NECTINs, contributing to the intricate process of viral entry. Notably, gD forms associations with both gB and the gH/gL heterodimer, essential components of the fusion complex, highlighting its multifaceted role in the viral entry process. Additionally, gD interacts with the UL11 tegument protein, further emphasizing its involvement in the intricate interplay of viral proteins during infection.

Virus

E. coli Cell-free

N-10*His

Q69467 (K26-Y393)

1487358

KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY

42.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.