glycoprotein D/gD Protein, HHV-2 (Cell-Free, His)
Glycoprotein D/gD proteins bind to host cell receptors TNFRSF14/HVEM and NECTIN1, triggering fusion with the host membrane by recruiting gB and gH/gL. glycoprotein D/gD Protein, HHV-2 (Cell-Free, His) is the recombinant Virus-derived glycoprotein D/gD protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Virus
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Glycoprotein D/gD proteins bind to host cell receptors TNFRSF14/HVEM and NECTIN1, triggering fusion with the host membrane by recruiting gB and gH/gL. glycoprotein D/gD Protein, HHV-2 (Cell-Free, His) is the recombinant Virus-derived glycoprotein D/gD protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
Envelope glycoprotein D (gD) plays a pivotal role in the viral life cycle by binding to potential host cell entry receptors, including TNFRSF14/HVEM and NECTIN1. Its interaction with these receptors may initiate fusion with the host membrane, a crucial step facilitated by the recruitment of the fusion machinery composed of gB and gH/gL. Existing as a homodimer, gD engages in various interactions with host receptors, such as TNFRSF14 and NECTINs, contributing to the intricate process of viral entry. Notably, gD forms associations with both gB and the gH/gL heterodimer, essential components of the fusion complex, highlighting its multifaceted role in the viral entry process. Additionally, gD interacts with the UL11 tegument protein, further emphasizing its involvement in the intricate interplay of viral proteins during infection.
Technical Parameters
-
Species Virus
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q69467 (K26-Y393)
-
Gene ID1487358
-
Molecular Construction
-
N-term
-
10*His
-
HHV-2 gD (K26-Y393)
Accession # Q69467 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PAEP; PP14 Protein (Placental Protein 14); Progestagen Associated Endometrial Protein; Zona-Binding Inhibitory Factor-1; Glycodelin; Alpha Uterine Protein; PP14; Placental Protein 14; PAEG; Glycodelin-A; GD; Glycodelin-S; Progesterone-Associated Endometri
-
AA Sequence
KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
-
Predicted Molecular Mass
42.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
