glycoprotein G/gG Protein, HHV-1 (Cell-Free, His)

The glycoprotein G/gG protein, functioning as a chemokine-binding protein, critically modulates immune responses by inhibiting neutrophil chemotaxis. It prevents the migration of neutrophils in response to chemokine signals, contributing to the fine-tuned control of immune cell recruitment and positioning within tissues. This highlights the protein's significance in orchestrating the immune system and maintaining immune homeostasis. glycoprotein G/gG Protein, HHV-1 (Cell-Free, His) is the recombinant Virus-derived glycoprotein G/gG protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of glycoprotein G/gG Protein, HHV-1 (Cell-Free, His) is 214 a.a., with molecular weight of 28.8 kDa.

The glycoprotein G/gG protein serves as a chemokine-binding protein, exerting its function by inhibiting the chemotaxis of neutrophils. This protein plays a critical role in modulating the movement of neutrophils, preventing their migration in response to chemokine signals. By acting as a regulator of neutrophil chemotaxis, glycoprotein G/gG contributes to the fine-tuned control of immune responses, influencing the recruitment and positioning of immune cells within tissues. This inhibition of neutrophil chemotaxis highlights the protein's significance in the intricate orchestration of the immune system and its potential role in maintaining immune homeostasis.

Virus

E. coli Cell-free

N-10*His

P06484 (V25-G238)

2703404

VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG

28.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.