GM-CSF Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GM-CSF protein, expressed by HEK293 , with N-hFc labeled tag.
Background
Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) is a cytokine known for its role in stimulating the growth and differentiation of hematopoietic precursor cells across various lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer. Its signaling mechanism involves interaction with the GM-CSF receptor complex, which forms a dodecamer consisting of two head-to-head hexamers involving two alpha, two beta, and two ligand subunits. Through this intricate receptor complex, GM-CSF orchestrates the regulation of hematopoiesis, contributing to the development and maturation of diverse blood cell types.
Verified Bioactivity
Immobilized Mouse GM-CSF R alpha, His Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Mouse GM-CSF, hFc Tag with the EC50 of <2.8 ng/mL determined by ELISA.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
P01587 (A18-K141)
-
Molecular Construction
-
N-term
-
hFc
-
GM-CSF (A18-K141)
Accession # P01587 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CSF2; Molgramostim; Colony Stimulating Factor 2; Molgramostin; GMCSF; CSF; Sargramostim; Granulocyte-Macrophage Colony Stimulating Factor; GM-CSF; Granulocyte Macrophage-Colony Stimulating Factor; Colony Stimulating Factor 2 (Granulocyte-Macrophage); Colo
-
AA Sequence
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
-
Predicted Molecular Mass
40 kDa
-
Molecular Weight
Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, PH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)