GMF-beta Protein, Mouse
Based on 1 Customer Validation
GMF-β protein is a multifaceted regulatory factor that coordinates brain cell differentiation, stimulates neuroregeneration, and inhibits tumor cell proliferation. Phosphorylation initiated by phorbol esters is critical for its activity, suggesting a dynamic regulatory mechanism in response to external signals. GMF-beta Protein, Mouse is the recombinant mouse-derived GMF-beta protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
GMF-β protein is a multifaceted regulatory factor that coordinates brain cell differentiation, stimulates neuroregeneration, and inhibits tumor cell proliferation. Phosphorylation initiated by phorbol esters is critical for its activity, suggesting a dynamic regulatory mechanism in response to external signals. GMF-beta Protein, Mouse is the recombinant mouse-derived GMF-beta protein, expressed by E. coli , with tag free.
Background
GMF-beta protein emerges as a multifaceted regulator, orchestrating the differentiation of brain cells, stimulating neural regeneration, and concurrently inhibiting the proliferation of tumor cells. This versatile protein undergoes phosphorylation, a modification crucial for its activity and notably triggered by phorbol ester. The phosphorylated state of GMF-beta suggests a dynamic regulatory mechanism responsive to external signals, potentially playing a pivotal role in cellular signaling cascades. With its dual capacity to influence both neural development and impede tumor cell proliferation, GMF-beta stands out as a crucial player in the intricate modulation of cellular fate and function, holding promise for further exploration in understanding and manipulating these fundamental biological processes.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9CQI3 (S2-H142)
-
Molecular Construction
-
N-term
-
GMF-beta (S2-H142)
Accession # Q9CQI3 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
GMFB; GMF; Glia Maturation Factor Beta; GMF-Beta
-
AA Sequence
SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
-
Predicted Molecular Mass
16.6 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)