GMF-beta Protein, Mouse

GMF-β protein is a multifaceted regulatory factor that coordinates brain cell differentiation, stimulates neuroregeneration, and inhibits tumor cell proliferation. Phosphorylation initiated by phorbol esters is critical for its activity, suggesting a dynamic regulatory mechanism in response to external signals. GMF-beta Protein, Mouse is the recombinant mouse-derived GMF-beta protein, expressed by E. coli , with tag free. The total length of GMF-beta Protein, Mouse is 141 a.a., with molecular weight of ~19.7 kDa.

GMF-beta protein emerges as a multifaceted regulator, orchestrating the differentiation of brain cells, stimulating neural regeneration, and concurrently inhibiting the proliferation of tumor cells. This versatile protein undergoes phosphorylation, a modification crucial for its activity and notably triggered by phorbol ester. The phosphorylated state of GMF-beta suggests a dynamic regulatory mechanism responsive to external signals, potentially playing a pivotal role in cellular signaling cascades. With its dual capacity to influence both neural development and impede tumor cell proliferation, GMF-beta stands out as a crucial player in the intricate modulation of cellular fate and function, holding promise for further exploration in understanding and manipulating these fundamental biological processes.

Data is not available.

Mouse

E. coli

Tag Free

Q9CQI3 (S2-H142)

63985  [NCBI]

SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Approximately 19.7 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.