GMP Vitronectin Protein, Human (HEK293, His)

Vitronectin is a key cell adhesion factor in serum and tissues and plays a crucial role in cell interactions by binding to glycosaminoglycans and proteoglycans. It is recognized by specific integrins and serves as an important adhesion molecule, facilitating cell-matrix interactions. GMP Vitronectin Protein, Human (HEK293, His) is the recombinant human-derived Vitronectin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GMP Vitronectin Protein, Human (HEK293, His) is 459 a.a., with molecular weight of 60-80 kDa.

Vitronectin, a pivotal cell adhesion and spreading factor present in both serum and tissues, plays a crucial role in cellular interactions. It engages with glycosaminoglycans and proteoglycans, demonstrating its versatility in molecular interactions. Recognized by specific integrins, Vitronectin serves as a vital cell-to-substrate adhesion molecule, facilitating cellular adhesion processes. Additionally, it acts as an inhibitor, mitigating the membrane-damaging effects associated with the terminal cytolytic complement pathway. Notably, Vitronectin establishes connections with various molecules, including SERPINE1/PAI1, insulin, and C1QBP, showcasing its involvement in diverse cellular processes.

Human

HEK293

C-6*His

AAH05046.1 (D20-L478)

7448  [NCBI]

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

60-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.