1. Recombinant Proteins
  2. Viral Proteins
  3. GP2b Protein, PRRSV (Cell-Free, His)

GP2b Protein, PRRSV (Cell-Free, His)

Cat. No.: HY-P702299
Handling Instructions

GP2b Protein, a minor envelope protein, potentially acts as a viroporin, aiding virus uncoating for genomic RNA release into the cytoplasm. It forms homooligomers, creating higher-order structures like dimers, trimers, and tetramers. GP2b is likely part of the GP2a-GP3-GP4 complex, contributing to the overall functionality of the viral envelope. GP2b Protein, PRRSV (Cell-Free, His) is the recombinant Virus-derived GP2b protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of GP2b Protein, PRRSV (Cell-Free, His) is 69 a.a., with molecular weight of 13.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GP2b Protein, a minor envelope protein, potentially acts as a viroporin, aiding virus uncoating for genomic RNA release into the cytoplasm. It forms homooligomers, creating higher-order structures like dimers, trimers, and tetramers. GP2b is likely part of the GP2a-GP3-GP4 complex, contributing to the overall functionality of the viral envelope. GP2b Protein, PRRSV (Cell-Free, His) is the recombinant Virus-derived GP2b protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of GP2b Protein, PRRSV (Cell-Free, His) is 69 a.a., with molecular weight of 13.7 kDa.

Background

GP2b protein, a minor envelope protein, potentially serves as a viroporin within the virion envelope, facilitating the uncoating of the virus for the release of genomic RNA into the cytoplasm, a crucial step for subsequent replication. It forms homooligomers and associates with itself to create higher-order structures, including dimers, trimers, and tetramers. Moreover, GP2b is likely to be part of the GP2a-GP3-GP4 complex, contributing to the overall functionality of the viral envelope.

Species

Virus

Source

E. coli Cell-free

Tag

N-10*His

Accession

P0C6Y6 (G2-L70)

Gene ID

/

Molecular Construction
N-term
10*His
GP2b (G2-L70)
Accession # P0C6Y6
C-term
Synonyms
Envelope small membrane protein; Glycoprotein 2b; Protein GP2b; Gs
AA Sequence

GSLWSKISQLFVDAFTEFLVSVVDIAIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAIHSPELSKVL

Molecular Weight

13.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GP2b Protein, PRRSV (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GP2b Protein, PRRSV (Cell-Free, His)
Cat. No.:
HY-P702299
Quantity:
MCE Japan Authorized Agent: