GPR15 Protein, Human (Cell-Free, His)

The GPR15 protein has been implicated as a possible chemokine receptor that may play a crucial role in cellular responses to chemotactic signals. Notably, GPR15 functions together with CD4 as an alternative coreceptor for HIV-1 infection, suggesting its involvement in viral entry into host cells. GPR15 Protein, Human (Cell-Free, His) is the recombinant human-derived GPR15 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of GPR15 Protein, Human (Cell-Free, His) is 360 a.a., with molecular weight of 43.6 kDa.

The GPR15 protein is identified as a probable chemokine receptor, signifying its potential involvement in cellular responses to chemotactic signals. Notably, GPR15 serves as an alternative coreceptor alongside CD4 for HIV-1 infection, suggesting its role in facilitating viral entry into host cells. This dual functionality implies that GPR15 plays a multifaceted role in both immune response regulation through chemokine signaling and in the context of viral pathogenesis by contributing to the entry process of HIV-1. The identification of GPR15 as a chemokine receptor and a potential coreceptor for HIV-1 underscores its significance in mediating diverse cellular processes.

Human

E. coli Cell-free

N-10*His

P49685 (M1-L360)

2838

MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL

43.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.