GPR157 Protein, Human (Cell-Free, His)

GPR157 Protein, an orphan receptor, crucially regulates neuronal differentiation in radial glial progenitors (RGPs). Its function relies on a G(q)-protein, activating a phosphatidylinositol-calcium second messenger to orchestrate intricate signaling pathways for neuronal differentiation. GPR157 Protein, Human (Cell-Free, His) is the recombinant human-derived GPR157 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of GPR157 Protein, Human (Cell-Free, His) is 335 a.a., with molecular weight of 39.4 kDa.

GPR157 Protein, an orphan receptor, serves as a key regulator in the promotion of neuronal differentiation within radial glial progenitors (RGPs). Its functional role is facilitated by a G(q)-protein, which, in turn, activates a phosphatidylinositol-calcium second messenger, orchestrating the intricate signaling pathways involved in the process of neuronal differentiation.

Human

E. coli Cell-free

N-10*His

Q5UAW9 (M1-T335)

80045

MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST

39.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.