1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. HAI-2 Protein, Human (HEK293, His)

HAI-2 Protein, Human (HEK293, His)

Cat. No.: HY-P70202
COA Handling Instructions

HAI-2 protein is a multifunctional inhibitor that regulates multiple cellular processes by potently inhibiting HGFAC and reducing serine protease activity, specifically TMPRSS13 and ST14/matriptase. HAI-2 is good at inhibiting plasmin, plasma and tissue kallikrein, with broad-spectrum inhibitory capabilities. HAI-2 Protein, Human (HEK293, His) is the recombinant human-derived HAI-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HAI-2 Protein, Human (HEK293, His) is 170 a.a., with molecular weight of 24-30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $107 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HAI-2 protein is a multifunctional inhibitor that regulates multiple cellular processes by potently inhibiting HGFAC and reducing serine protease activity, specifically TMPRSS13 and ST14/matriptase. HAI-2 is good at inhibiting plasmin, plasma and tissue kallikrein, with broad-spectrum inhibitory capabilities. HAI-2 Protein, Human (HEK293, His) is the recombinant human-derived HAI-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HAI-2 Protein, Human (HEK293, His) is 170 a.a., with molecular weight of 24-30 kDa.

Background

HAI-2, a versatile protein with a multifaceted inhibitory role, emerges as a potent regulator in diverse cellular processes. Its inhibitory prowess extends to HGFAC, acting as a robust sentinel against its activities. Beyond this, HAI-2 demonstrates proficiency in inhibiting plasmin, as well as plasma and tissue kallikrein, highlighting its broad-spectrum inhibitory capabilities. Notably, HAI-2 is a key modulator of serine protease activities, curtailing the functions of TMPRSS13 and ST14/matriptase in vitro. The intricate dance of molecular interactions includes a direct engagement with TMPRSS13, orchestrating an interplay that not only inhibits but also facilitates the phosphorylation and cellular localization of this serine protease. In essence, HAI-2 emerges as a versatile guardian, intricately navigating the cellular landscape to fine-tune serine protease activities and maintain a delicate balance in various physiological contexts.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O43291 (A28-K197)

Gene ID
Molecular Construction
N-term
HAI-2 (A28-K197)
Accession # O43291
6*His
C-term
Synonyms
rHuKunitz-type protease inhibitor 2/HAI-2, His; Kunitz-Type Protease Inhibitor 2; Hepatocyte Growth Factor Activator Inhibitor Type 2; HAI-2; Placental Bikunin; SPINT2; HAI2; KOP
AA Sequence

ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

Molecular Weight

24-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HAI-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HAI-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70202
Quantity:
MCE Japan Authorized Agent: