Copy Link Print Information

HAI-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

HAI-2 protein is a multifunctional inhibitor that regulates multiple cellular processes by potently inhibiting HGFAC and reducing serine protease activity, specifically TMPRSS13 and ST14/matriptase. HAI-2 is good at inhibiting plasmin, plasma and tissue kallikrein, with broad-spectrum inhibitory capabilities. HAI-2 Protein, Human (HEK293, His) is the recombinant human-derived HAI-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for HAI-2 Protein, Human (HEK293, His)
  • HAI-2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HAI-2 protein is a multifunctional inhibitor that regulates multiple cellular processes by potently inhibiting HGFAC and reducing serine protease activity, specifically TMPRSS13 and ST14/matriptase. HAI-2 is good at inhibiting plasmin, plasma and tissue kallikrein, with broad-spectrum inhibitory capabilities. HAI-2 Protein, Human (HEK293, His) is the recombinant human-derived HAI-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

HAI-2, a versatile protein with a multifaceted inhibitory role, emerges as a potent regulator in diverse cellular processes. Its inhibitory prowess extends to HGFAC, acting as a robust sentinel against its activities. Beyond this, HAI-2 demonstrates proficiency in inhibiting plasmin, as well as plasma and tissue kallikrein, highlighting its broad-spectrum inhibitory capabilities. Notably, HAI-2 is a key modulator of serine protease activities, curtailing the functions of TMPRSS13 and ST14/matriptase in vitro. The intricate dance of molecular interactions includes a direct engagement with TMPRSS13, orchestrating an interplay that not only inhibits but also facilitates the phosphorylation and cellular localization of this serine protease. In essence, HAI-2 emerges as a versatile guardian, intricately navigating the cellular landscape to fine-tune serine protease activities and maintain a delicate balance in various physiological contexts.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O43291-1 (A28-K197)

  • Gene ID
    10653  [NCBI]
  • Molecular Construction
    • N-term
    • HAI-2 (A28-K197)
      Accession # O43291-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SPINT2; Hepatocyte Growth Factor Activator Inhibitor-2; Serine Peptidase Inhibitor, Kunitz Type 2; Serine Protease Inhibitor, Kunitz Type, 2; HAI-2; HGF Activator Inhibitor 2; HAI2; Placental Bikunin; Hepatocyte Growth Factor Activator Inhibitor Type 2; T

  • AA Sequence

    ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

  • Predicted Molecular Mass

    20.2 kDa

  • Molecular Weight

    Approximately 24-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • HAI-2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for HAI-2 Protein, Human (HEK293, His)
  • HAI-2 Protein, Human (HEK293, His) Product Image