HFE Protein, Mouse (Cell-Free, His)

HFE Protein is crucial, binding to transferrin receptor (TFR) and reducing its affinity for iron-loaded transferrin. The interaction, pH-dependent and mediated by HFE's extracellular domain, highlights intricate molecular mechanisms. By modulating TFR's affinity, HFE plays a pivotal role in regulating iron homeostasis, emphasizing its significance in cellular processes related to iron uptake and metabolism. HFE Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived HFE protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of HFE Protein, Mouse (Cell-Free, His) is 335 a.a., with molecular weight of 39.5 kDa.

The HFE protein assumes a crucial role as it binds to the transferrin receptor (TFR), effectively reducing its affinity for iron-loaded transferrin. This interaction occurs through the extracellular domain of HFE in a pH-dependent manner, emphasizing the intricacies of the molecular mechanisms involved. By modulating the affinity of TFR for iron-loaded transferrin, HFE plays a pivotal role in the regulation of iron homeostasis, showcasing its significance in cellular processes related to iron uptake and metabolism.

Mouse

E. coli Cell-free

N-10*His

P70387 (Q25-E359)

15216

QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE

39.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.