HLA-DPB1 Protein, Human (His)
Based on 1 Customer Validation
HLA-DPB belongs to the HLA class II β-chain paralog. HLA-DPB1 Protein, Human (His) is a recombinant human HLA-DPB1 protein expressed by E. coli and tagged with N-His.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HLA-DPB belongs to the HLA class II β-chain paralog. HLA-DPB1 Protein, Human (His) is a recombinant human HLA-DPB1 protein expressed by E. coli and tagged with N-His.
HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P04440 (R30-R223)
-
Molecular Construction
-
N-term
-
His
-
HLA-DPB1 (R30-R223)
Accession # P04440 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
HLA-DPB1; MHC Class II Molecule; Prev. HLA-DP1B; MHC-Class II Antigen; HLA Class II Histocompatibility Antigen, DP Beta 1 Chain; MHC Class II Protein; MHC Class II Antigen DPB1; HLA Class II Antigen; HLA Class II Histocompatibility Antigen, DP(W4) Beta Ch
-
AA Sequence
RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR
-
Predicted Molecular Mass
26.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
