HLA-DPB1 Protein, Human (His)

The HLA-DPB1 protein is an integral part of the immune system, binding antigens in the endocytic pathway of antigen-presenting cells (APCs). It presents the peptide on the cell surface for recognition by CD4 T cells. HLA-DPB1 Protein, Human (His) is the recombinant human-derived HLA-DPB1 protein, expressed by E. coli , with N-His labeled tag. The total length of HLA-DPB1 Protein, Human (His) is 194 a.a., with molecular weight of ~26.8 kDa.

The HLA-DPB1 Protein plays a pivotal role in the immune system by binding peptides derived from antigens within the endocytic route of antigen-presenting cells (APCs) and presenting them on the cell surface for recognition by CD4 T-cells. The peptide binding cleft of HLA-DPB1 accommodates peptides ranging from 10 to 30 residues, predominantly generated through the degradation of proteins accessing the endocytic route. This exogenous antigen presentation pathway involves lysosomal proteases and other hydrolases processing antigens taken up by APCs. Notably, cells of the gastrointestinal tract, including epithelial cells, express MHC class II molecules and CD74, acting as unconventional APCs. The assembly of a functional MHC class II molecule involves the association of three MHC class II molecules with a CD74 trimer in the endoplasmic reticulum (ER), forming a heterononamer. Upon entering the endosomal/lysosomal system, CD74 undergoes sequential degradation, leaving a fragment known as CLIP on each MHC class II molecule. HLA-DM facilitates CLIP removal, stabilizing MHC class II until high-affinity antigenic peptides bind. HLA-DO regulates the interaction between HLA-DM and MHC class II in B-cells, and lysosomal acidification influences efficient peptide loading. The MHC class II molecule, bound to a peptide, is then transported to the cell membrane surface for immune recognition.

Human

E. coli

N-His

P04440 (R30-R223)

3115  [NCBI]

RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR

Approximately 26.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.