1. Recombinant Proteins
  2. Others
  3. HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution)

HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution)

Cat. No.: HY-P73104
COA Handling Instructions

HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution) is the recombinant mouse-derived HMGB1/HMG-1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution) is 215 a.a., with molecular weight of ~57 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $100 In-stock
10 μg $160 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution) is the recombinant mouse-derived HMGB1/HMG-1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution) is 215 a.a., with molecular weight of ~57 kDa.

Background

HMGB1/HMG-1 protein, a multifunctional redox-sensitive molecule, assumes diverse roles across different cellular compartments. Within the nucleus, it stands as a major chromatin-associated non-histone protein, functioning as a DNA chaperone pivotal in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. Proposed as a universal biosensor for nucleic acids, HMGB1 also plays a crucial role in promoting host inflammatory responses to both sterile and infectious signals, contributing to the coordination and integration of innate and adaptive immune responses. In the cytoplasm, it serves as a sensor and/or chaperone for immunogenic nucleic acids, activating TLR9-mediated immune responses and mediating autophagy. Operating as a danger-associated molecular pattern (DAMP) molecule, HMGB1 amplifies immune responses during tissue injury. Upon release into the extracellular environment, it binds to a spectrum of molecules such as DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS), and lipoteichoic acid (LTA), activating cells through engagement with multiple surface receptors. The extracellular HMGB1 exhibits distinct functionalities, with fully reduced HMGB1 acting as a chemokine, disulfide HMGB1 functioning as a cytokine, and sulfonyl HMGB1 from apoptotic cells promoting immunological tolerance. Beyond its immunomodulatory roles, HMGB1 demonstrates proangiogenic activity and may be involved in platelet activation. It engages in various cellular functions, including binding to phosphatidylserine and phosphatidylethanolamide, mediating signaling for neuronal outgrowth via RAGE, and potentially contributing to the accumulation of expanded polyglutamine (polyQ) proteins. In the nucleus, its nuclear functions are attributed to fully reduced HMGB1, associating with chromatin, binding DNA with a preference for non-canonical DNA structures, and participating in DNA repair pathways, including nucleotide excision repair (NER), mismatch repair (MMR), base excision repair (BER), and double-strand break repair such as non-homologous end joining (NHEJ). HMGB1 also acts as a cofactor of the RAG complex in V(D)J recombination, displaces histone H1 from highly bent DNA in vitro, and can restructure the canonical nucleosome, leading to relaxation of structural constraints for transcription factor binding. Furthermore, it enhances the binding of sterol regulatory element-binding proteins (SREBPs) like SREBF1 to their cognate DNA sequences, increases their transcriptional activities, and facilitates the binding of TP53 to DNA. While proposed to be involved in mitochondrial quality control and autophagy in a transcription-dependent fashion, this function has been subject to debate. Additionally, HMGB1 can modulate the activity of the telomerase complex and may be implicated in telomere maintenance. Overall, HMGB1 emerges as a versatile protein with intricate roles in cellular processes across diverse cellular compartments.

Biological Activity

Measured by its ability to bind mouse AGER-His in functional ELISA.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P63158 (M1-E215)

Gene ID

15289  [NCBI]

Molecular Construction
N-term
hFc
HMGB1 (M1-E215)
Accession # P63158
C-term
Synonyms
High mobility group protein B1; HMG-1; HMGB1; HMG1
AA Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Molecular Weight

Approximately 57 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HMGB1/HMG-1 Protein, Mouse (HEK293, Fc, solution)
Cat. No.:
HY-P73104
Quantity:
MCE Japan Authorized Agent: